Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10299
Gene name
LocationContig_819:8203..10649
Strand-
Gene length (bp)2446
Transcript length (bp)1608
Coding sequence length (bp)1608
Protein length (aa) 536

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 2.1E-38 100 486
PF00083 Sugar_tr Sugar (and other) transporter 1.2E-11 106 290

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 64 533 7.0E-124
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 1 535 1.0E-88
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 4 535 1.0E-87
sp|O59699|YN42_SCHPO Uncharacterized transporter C36.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.02c PE=3 SV=1 88 535 3.0E-83
sp|P32071|CYHR_CANMA Cycloheximide resistance protein OS=Candida maltosa GN=CYHR PE=3 SV=1 15 533 2.0E-82
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 64 533 7.0E-124
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 1 535 1.0E-88
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 4 535 1.0E-87
sp|O59699|YN42_SCHPO Uncharacterized transporter C36.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.02c PE=3 SV=1 88 535 3.0E-83
sp|P32071|CYHR_CANMA Cycloheximide resistance protein OS=Candida maltosa GN=CYHR PE=3 SV=1 15 533 2.0E-82
sp|O74829|YN2F_SCHPO Uncharacterized MFS-type transporter C530.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.15c PE=1 SV=2 61 531 9.0E-82
sp|Q9Y7S4|YQO5_SCHPO Uncharacterized transporter C569.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC569.05c PE=3 SV=1 13 533 1.0E-81
sp|O59738|YN22_SCHPO Uncharacterized transporter C530.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.02 PE=3 SV=1 64 535 8.0E-81
sp|Q7Z9I0|YHA8_SCHPO Uncharacterized MFS-type transporter C409.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC409.08 PE=3 SV=1 61 533 2.0E-80
sp|P38124|FLR1_YEAST Fluconazole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLR1 PE=1 SV=1 61 535 6.0E-80
sp|Q5ABU7|MDR1_CANAL Multidrug resistance protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MDR1 PE=1 SV=1 69 534 5.0E-79
sp|P28873|BMRP_CANAX Benomyl/methotrexate resistance protein OS=Candida albicans GN=MDR1 PE=3 SV=1 69 534 5.0E-79
sp|O59700|YN43_SCHPO Uncharacterized transporter C36.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.03c PE=3 SV=1 10 531 2.0E-77
sp|O94528|CAF5_SCHPO Caffeine resistance protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=caf5 PE=3 SV=1 40 534 5.0E-77
sp|Q10487|MFS1_SCHPO Transporter mfs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs1 PE=3 SV=1 69 533 2.0E-75
sp|Q07824|TPO1_YEAST Polyamine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO1 PE=1 SV=1 63 533 8.0E-75
sp|O59698|YN41_SCHPO Uncharacterized transporter C36.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.01c PE=1 SV=1 6 535 8.0E-74
sp|P53283|TPO2_YEAST Polyamine transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO2 PE=1 SV=1 77 529 2.0E-72
sp|Q06451|TPO3_YEAST Polyamine transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO3 PE=1 SV=1 51 529 2.0E-72
sp|Q12256|TPO4_YEAST Polyamine transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO4 PE=1 SV=1 65 533 8.0E-72
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 63 530 3.0E-71
sp|Q9P3V5|YI45_SCHPO Uncharacterized transporter C1348.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1348.05 PE=3 SV=1 77 527 1.0E-67
sp|Q9P3E8|YLZ2_SCHPO Uncharacterized transporter C750.02c/PB2B2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC750.02c PE=3 SV=1 77 527 8.0E-67
sp|O43081|YHS6_SCHPO Uncharacterized MFS-type transporter C947.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC947.06c PE=3 SV=1 24 534 7.0E-66
sp|Q9HDX4|MFC1_SCHPO Uncharacterized transporter mfc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfc1 PE=3 SV=2 106 532 9.0E-62
sp|P33532|BSU1_SCHPO Vitamin B6 transporter bsu1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bsu1 PE=3 SV=2 49 530 1.0E-45
sp|O59833|YCUD_SCHPO Uncharacterized transporter C965.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC965.13 PE=3 SV=1 24 533 4.0E-41
sp|O74899|YQEH_SCHPO Uncharacterized transporter C576.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC576.17c PE=1 SV=1 25 535 4.0E-35
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 89 289 4.0E-25
sp|G2TRN8|YI74_SCHPO Putative uncharacterized transporter C977.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC977.04 PE=5 SV=1 378 527 2.0E-23
sp|P38125|DTR1_YEAST Dityrosine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DTR1 PE=1 SV=1 106 513 1.0E-18
sp|P40474|QDR2_YEAST Quinidine resistance protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR2 PE=1 SV=1 140 526 7.0E-18
sp|P40475|QDR1_YEAST Quinidine resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR1 PE=1 SV=1 26 533 5.0E-17
sp|P53943|AQR1_YEAST Probable transporter AQR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AQR1 PE=1 SV=1 84 485 4.0E-16
sp|P53389|HOL1_YEAST Protein HOL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOL1 PE=1 SV=1 78 308 3.0E-15
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 89 269 4.0E-15
sp|P45123|BCR_HAEIN Bicyclomycin resistance protein homolog OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=bcr PE=3 SV=1 132 271 1.0E-12
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 387 534 1.0E-11
sp|Q59YT1|QDR2_CANAL MFS antiporter QDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR2 PE=3 SV=1 75 483 1.0E-11
sp|P28246|BCR_ECOLI Bicyclomycin resistance protein OS=Escherichia coli (strain K12) GN=bcr PE=1 SV=4 92 288 2.0E-11
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 301 497 9.0E-09
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 34 269 2.0E-08
sp|P96709|YDGK_BACSU Uncharacterized MFS-type transporter YdgK OS=Bacillus subtilis (strain 168) GN=ydgK PE=3 SV=1 109 256 2.0E-08
sp|P31442|EMRD_ECOLI Multidrug resistance protein D OS=Escherichia coli (strain K12) GN=emrD PE=1 SV=2 106 269 2.0E-08
sp|Q1RI77|BCRH_RICBR Uncharacterized transporter RBE_0856 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0856 PE=3 SV=1 108 269 6.0E-08
sp|O34307|YVMA_BACSU Uncharacterized MFS-type transporter YvmA OS=Bacillus subtilis (strain 168) GN=yvmA PE=3 SV=1 86 260 2.0E-07
sp|P32482|CMLA_PSEAI Chloramphenicol resistance protein OS=Pseudomonas aeruginosa GN=cmlA PE=3 SV=2 130 269 3.0E-07
sp|Q5A6P6|QDR1_CANAL MFS antiporter QDR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR PE=2 SV=1 106 505 3.0E-07
sp|P37597|YDHC_ECOLI Inner membrane transport protein YdhC OS=Escherichia coli (strain K12) GN=ydhC PE=1 SV=3 106 269 5.0E-07
sp|Q7Z118|YMPB_CAEEL Putative transporter B0361.11 OS=Caenorhabditis elegans GN=B0361.11 PE=3 SV=2 131 283 5.0E-07
sp|Q4UMJ9|BCRH_RICFE Uncharacterized transporter RF_0358 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0358 PE=3 SV=1 108 248 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

Domain # Start End Length
1 90 112 22
2 127 149 22
3 156 173 17
4 183 205 22
5 218 240 22
6 244 266 22
7 324 346 22
8 361 383 22
9 407 429 22
10 434 456 22
11 463 485 22
12 500 522 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10299
MQQQKPQRASEQSDRPAADIPDFESDHSTVPPSSQLPPPERVRTQNGYGVSEEHGRAGAGVGEKDPFEVSWDGGD
ADPSCPRSMARGRKWLIVFIVSHASLCFTCASSVYTSTYEQMEAEFHNSRIVSVLGLSSFVLGIGLGPMFLSPLS
EFYGRRPIYLVAWTAYLIWFVPQAVAKHIAITIVFRFMSGFSGSAFLAVSGGTVSDLFAKQELQAPMALFSMSPF
IGPSLGPLIGGFINYYVDWRWTYYVLVIWSFVLWVAIIFFVPETYHPILLRNKARRLRTETGDDRWIAPGESVKR
SVLTAVGRSLLRPFQLLIFEPMCLCLCLFSALLLGILYLLFGAMPLVFGTNHDFNLWNNGLAFLGIAVGVLLGVA
TDPLWYRVRIHLIRRHERETGVKDDSEPEFRLPPAILGSVLVPIGLFTFGWSTYPWVPWIVPIIGSAIFGTGNVL
LFTGIFTFLVDAYPLYAASALAANAFVRCLFAATFPLFGNQMYKKLGFQWASTLLALLTTAMLPFPYLFFRYGKQ
IRARSRFAKE*
Coding >Hirsu2|10299
ATGCAGCAGCAAAAGCCGCAGAGGGCCTCGGAGCAGTCCGACCGCCCGGCGGCCGACATCCCCGACTTCGAGTCC
GACCACTCGACCGTGCCGCCGTCCAGCCAGCTGCCGCCGCCCGAGAGGGTCCGGACGCAGAACGGCTACGGCGTG
TCGGAGGAGCACGGTCGTGCCGGCGCCGGCGTCGGAGAAAAGGACCCGTTCGAGGTGAGCTGGGACGGCGGCGAC
GCCGACCCGTCGTGTCCTCGAAGCATGGCCCGGGGCCGCAAATGGCTCATCGTCTTCATCGTCTCGCACGCCAGC
CTGTGCTTCACCTGCGCCAGCTCCGTCTACACGTCGACGTATGAGCAGATGGAAGCCGAGTTCCATAACTCCAGA
ATCGTCTCCGTCCTCGGGCTCTCAAGCTTCGTGCTGGGCATCGGCCTCGGGCCCATGTTTCTCAGCCCGCTGAGC
GAGTTTTACGGCCGCCGGCCCATCTACCTCGTGGCCTGGACCGCCTATCTCATCTGGTTCGTCCCGCAGGCCGTG
GCCAAGCACATCGCCATCACCATCGTCTTCCGCTTCATGAGCGGCTTCTCTGGCAGTGCCTTTCTGGCCGTGTCC
GGCGGCACTGTCAGCGACCTTTTCGCCAAGCAAGAGCTGCAGGCCCCCATGGCCCTCTTTTCCATGAGCCCTTTC
ATTGGGCCGAGCCTCGGCCCTTTGATCGGGGGCTTCATCAACTACTATGTTGATTGGCGCTGGACTTATTACGTG
CTCGTAATCTGGTCCTTTGTCCTTTGGGTAGCCATTATATTCTTTGTTCCCGAGACGTACCACCCCATCTTATTG
AGAAACAAGGCACGTAGACTCCGCACGGAGACGGGAGACGACAGATGGATCGCCCCGGGCGAGAGCGTCAAGCGG
TCCGTCCTGACGGCGGTTGGACGATCGCTGCTTCGCCCCTTTCAACTGCTCATCTTCGAACCCATGTGCCTCTGC
CTCTGCCTGTTCTCCGCCCTGCTCCTGGGTATCCTCTACCTCCTCTTTGGGGCCATGCCCCTCGTCTTCGGCACC
AATCATGACTTCAACCTATGGAATAACGGACTGGCCTTCTTGGGCATCGCGGTGGGCGTGCTTCTGGGCGTGGCG
ACTGATCCGTTGTGGTACCGCGTCCGCATTCACCTCATTCGCAGGCACGAGCGCGAGACCGGGGTTAAGGACGAC
AGCGAGCCCGAGTTTCGACTGCCTCCCGCCATCCTTGGCTCTGTGCTGGTTCCCATCGGTCTGTTCACGTTTGGG
TGGTCGACGTACCCGTGGGTGCCCTGGATTGTGCCCATCATTGGGTCGGCCATATTTGGAACCGGCAACGTGTTG
CTCTTCACAGGCATCTTCACATTTCTGGTCGACGCCTATCCGCTGTACGCAGCGAGCGCGCTCGCGGCCAACGCA
TTCGTCCGCTGTCTGTTTGCCGCGACGTTCCCCCTATTCGGAAATCAGATGTATAAGAAGCTGGGCTTCCAATGG
GCCTCGACGCTGCTCGCCTTGCTGACGACCGCCATGCTGCCATTCCCGTACCTCTTCTTTCGCTACGGCAAGCAA
ATTCGAGCCAGGAGCCGATTTGCCAAGGAGTAG
Transcript >Hirsu2|10299
ATGCAGCAGCAAAAGCCGCAGAGGGCCTCGGAGCAGTCCGACCGCCCGGCGGCCGACATCCCCGACTTCGAGTCC
GACCACTCGACCGTGCCGCCGTCCAGCCAGCTGCCGCCGCCCGAGAGGGTCCGGACGCAGAACGGCTACGGCGTG
TCGGAGGAGCACGGTCGTGCCGGCGCCGGCGTCGGAGAAAAGGACCCGTTCGAGGTGAGCTGGGACGGCGGCGAC
GCCGACCCGTCGTGTCCTCGAAGCATGGCCCGGGGCCGCAAATGGCTCATCGTCTTCATCGTCTCGCACGCCAGC
CTGTGCTTCACCTGCGCCAGCTCCGTCTACACGTCGACGTATGAGCAGATGGAAGCCGAGTTCCATAACTCCAGA
ATCGTCTCCGTCCTCGGGCTCTCAAGCTTCGTGCTGGGCATCGGCCTCGGGCCCATGTTTCTCAGCCCGCTGAGC
GAGTTTTACGGCCGCCGGCCCATCTACCTCGTGGCCTGGACCGCCTATCTCATCTGGTTCGTCCCGCAGGCCGTG
GCCAAGCACATCGCCATCACCATCGTCTTCCGCTTCATGAGCGGCTTCTCTGGCAGTGCCTTTCTGGCCGTGTCC
GGCGGCACTGTCAGCGACCTTTTCGCCAAGCAAGAGCTGCAGGCCCCCATGGCCCTCTTTTCCATGAGCCCTTTC
ATTGGGCCGAGCCTCGGCCCTTTGATCGGGGGCTTCATCAACTACTATGTTGATTGGCGCTGGACTTATTACGTG
CTCGTAATCTGGTCCTTTGTCCTTTGGGTAGCCATTATATTCTTTGTTCCCGAGACGTACCACCCCATCTTATTG
AGAAACAAGGCACGTAGACTCCGCACGGAGACGGGAGACGACAGATGGATCGCCCCGGGCGAGAGCGTCAAGCGG
TCCGTCCTGACGGCGGTTGGACGATCGCTGCTTCGCCCCTTTCAACTGCTCATCTTCGAACCCATGTGCCTCTGC
CTCTGCCTGTTCTCCGCCCTGCTCCTGGGTATCCTCTACCTCCTCTTTGGGGCCATGCCCCTCGTCTTCGGCACC
AATCATGACTTCAACCTATGGAATAACGGACTGGCCTTCTTGGGCATCGCGGTGGGCGTGCTTCTGGGCGTGGCG
ACTGATCCGTTGTGGTACCGCGTCCGCATTCACCTCATTCGCAGGCACGAGCGCGAGACCGGGGTTAAGGACGAC
AGCGAGCCCGAGTTTCGACTGCCTCCCGCCATCCTTGGCTCTGTGCTGGTTCCCATCGGTCTGTTCACGTTTGGG
TGGTCGACGTACCCGTGGGTGCCCTGGATTGTGCCCATCATTGGGTCGGCCATATTTGGAACCGGCAACGTGTTG
CTCTTCACAGGCATCTTCACATTTCTGGTCGACGCCTATCCGCTGTACGCAGCGAGCGCGCTCGCGGCCAACGCA
TTCGTCCGCTGTCTGTTTGCCGCGACGTTCCCCCTATTCGGAAATCAGATGTATAAGAAGCTGGGCTTCCAATGG
GCCTCGACGCTGCTCGCCTTGCTGACGACCGCCATGCTGCCATTCCCGTACCTCTTCTTTCGCTACGGCAAGCAA
ATTCGAGCCAGGAGCCGATTTGCCAAGGAGTAG
Gene >Hirsu2|10299
ATGCAGCAGCAAAAGCCGCAGAGGGCCTCGGAGCAGTCCGACCGCCCGGCGGCCGACATCCCCGACTTCGAGTCC
GACCACTCGACCGTGCCGCCGTCCAGCCAGCTGCCGCCGCCCGAGAGGGTCCGGACGCAGAACGGCTACGGCGTG
TCGGAGGAGCACGGTCGTGCCGGCGCCGGCGTCGGAGAAAAGGACCCGTTCGAGGTGAGCTGGGACGGCGGCGAC
GCCGACCCGTCGTGTCCTCGAAGCATGGCCCGGGGCCGCAAATGGCTCATCGTCTTCATCGTCTCGCACGCCAGC
CTGTGCTTGTAAGTGCTCTCGCCTTGTTTTCCTCCGGTCTTCTTAGCGAGGAAAAGAGAGAGGCAAGGGGGAGAT
GGAGAGGGAGGCCGGCAGCGGCAGCGGAAGTGGCTCACCATCTCGGTCCCCCCCCCCCAACCCCTAACCCACTTC
TCCTTTCTGCAGCACCTGCGCCAGCTCCGTCTACACGTCGACGTATGAGCAGATGGAAGCCGAGTTCCATAACTC
CAGAATCGTCTCCGTCCTCGGGCTCTCAAGCTTCGTGCTGGGCATCGGCCTCGGGCCCATGTTTCTCAGCCCGCT
GAGCGAGTTTTACGGCCGCCGGCCCATCTACCTCGTGGCCTGGACCGCCTATCTCATCTGGTTCGTCCCGCAGGC
CGTGGCCAAGCACATCGCCATCACCATCGTCTTCCGCTTCATGAGCGGCTTCTCTGGCAGTGCCTTTCTGGCCGT
GTCCGGCGGCACTGTCAGCGACCTTTTCGCCAAGCAAGAGCTGCAGGCCCCCATGGCCCTCTTTTCCATGAGCCC
TTTCATTGGGCCGAGCCTCGGCCCTTTGATCGGGGGCTTCATCAACTACTATGTTGATTGGCGCTGGACTTATTA
CGTGCTCGTAATCTGGTCCTTTGTCCTTTGGGTAGCCATTATATTCTTTGTTCCCGAGACGTACCGTACGCTTTC
TCCCCCCCTATGCTTCTCCCTCCCCTTTCCCTCGCCCACTGCTTCCGCATCTCTCCGCTCGGCCGCCAGGGCCGG
TATGTCTCACTTCCAGCTCGCTCGAGGGGGAAGGAAAGAGAAAATGACTGACACGAGCGTGCTTTGGGTGGAGCT
GCCAGACCCCATCTTATTGAGAAACAAGGCACGTAGACTCCGCACGGAGACGGGAGACGACAGATGGATCGCCCC
GGGCGAGAGCGTCAAGCGGTCCGTCCTGACGGCGGTTGGACGATCGCTGCTTCGCCCCTTTCAACTGCTCATCTT
CGAACCCATGTGCCTCTGCCTCTGCCTGTTCTCCGCCCTGCTCCTGGGTATCCTCTACCTCCTCTTTGGGGCCAT
GCCCCTCGTCTTCGGCACCAATCATGACTTCAACCTATGGAATAACGGACTGGCCTTCTTGGGCATCGCGGTGGG
CGTGCTTCTGGGCGTGGCGACTGATCCGTTGTGGTACCGCGTCCGCATTCACCTCATTCGCAGGCACGAGCGCGA
GACCGGGGTTAAGGACGACAGCGAGCCCGAGTTTCGACTGCCTCCCGCCATCCTTGGCTCTGTGCTGGTTCCCAT
CGGTCTGTTCACGTTTGGGTGGTCGACGTACCCGTGGGTGCCCTGGATTGTGCCCATCATTGGGTCGGCCATATT
TGGAACCGGGTAAGTTGTGTCCAGCCACGTGTTGCACAGCATGCCTATCAGGACATGTTGTGCTGTCTAGCATTG
TGAAAGAAGGGGGGGAGGGTTGGGAGAGCAGGGAGGAGACGAGGGGGTCAAGGGGGGAGTCCGGCGCTCGCTGCT
CTTGTACGAGGCGATTTCCAGTCCAGTTGGGTTGCGAGGATCGTTGATCGTGACCACGGTCCGGCCTTGCTTGGG
GCGTTGGTGTAGCTTGGACATGGCCGTCGAGCGAGCCCAGACCTCCCCCACCCCCCTCGGTCGGCGCAGAGCTCC
ATGTTTGATTGTCTGGCGTCGAGGGGTTATTCGGTGGCCGTGGCTGACGATTGACACGGCACAGCAACGTGTTGC
TCTTCACAGGCATCTTCACATTTCTGGTAAGTCAATCAGATGCGGCCTCCCGGCGGAGTTATCATGGCCGCTTAC
CATGTTCACGCCAAAGGTCGACGCCTATCCGCTGTACGCAGCGAGCGCGCTCGCGGCCAACGCATTCGTCCGCTG
TCTGTTTGCCGGTAAGATGACTGACCCAGCAAGCATGGGCAATCATGGCATGCTTGGCTTGCTTCTGCGGTCGAA
CGTAGGACGCAGATGATACTAACTCAGGGCCACAGCGACGTTCCCCCTATTCGGAAATCAGATGTATAAGAAGCT
GGGCTTCCAATGGGCCTCGACGCTGCTCGCCTTGCTGACGACCGCCATGCTGCCATTCCCGTACCTCTTCTTTCG
CTACGGCAAGCAAATTCGAGCCAGGAGCCGATTTGCCAAGGAGTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail