© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | Hirsu2|10296 |
| Gene name | |
| Location | Contig_819:825..1534 |
| Strand | + |
| Gene length (bp) | 709 |
| Transcript length (bp) | 564 |
| Coding sequence length (bp) | 564 |
| Protein length (aa) | 188 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF01687 | Flavokinase | Riboflavin kinase | 8.6E-36 | 19 | 165 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|P0C5D9|RIFK_CHAGB | Riboflavin kinase OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=FMN1 PE=3 SV=1 | 4 | 186 | 1.0E-77 |
| sp|A4QQ05|RIFK_MAGO7 | Riboflavin kinase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=FMN1 PE=3 SV=3 | 1 | 186 | 2.0E-70 |
| sp|Q6M923|RIFK_NEUCR | Riboflavin kinase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fmn1 PE=3 SV=2 | 4 | 171 | 5.0E-67 |
| sp|A1C603|RIFK_ASPCL | Riboflavin kinase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=fmn1 PE=3 SV=1 | 5 | 184 | 3.0E-47 |
| sp|Q0CHR1|RIFK_ASPTN | Riboflavin kinase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=fmn1 PE=3 SV=1 | 3 | 170 | 2.0E-46 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|P0C5D9|RIFK_CHAGB | Riboflavin kinase OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=FMN1 PE=3 SV=1 | 4 | 186 | 1.0E-77 |
| sp|A4QQ05|RIFK_MAGO7 | Riboflavin kinase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=FMN1 PE=3 SV=3 | 1 | 186 | 2.0E-70 |
| sp|Q6M923|RIFK_NEUCR | Riboflavin kinase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fmn1 PE=3 SV=2 | 4 | 171 | 5.0E-67 |
| sp|A1C603|RIFK_ASPCL | Riboflavin kinase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=fmn1 PE=3 SV=1 | 5 | 184 | 3.0E-47 |
| sp|Q0CHR1|RIFK_ASPTN | Riboflavin kinase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=fmn1 PE=3 SV=1 | 3 | 170 | 2.0E-46 |
| sp|Q5AW61|RIFK_EMENI | Riboflavin kinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=fmn1 PE=3 SV=1 | 2 | 183 | 4.0E-46 |
| sp|Q2UMM4|RIFK_ASPOR | Riboflavin kinase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=fmn1 PE=3 SV=1 | 5 | 170 | 2.0E-45 |
| sp|Q4WHD2|RIFK_ASPFU | Riboflavin kinase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=fmn1 PE=3 SV=1 | 5 | 170 | 3.0E-44 |
| sp|A1DG00|RIFK_NEOFI | Riboflavin kinase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=fmn1 PE=3 SV=1 | 5 | 170 | 8.0E-43 |
| sp|A2QFH1|RIFK_ASPNC | Riboflavin kinase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=fmn1 PE=3 SV=1 | 5 | 171 | 2.0E-42 |
| sp|O74866|RIFK_SCHPO | Riboflavin kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fmn1 PE=1 SV=1 | 1 | 177 | 3.0E-42 |
| sp|A3M0C9|RIFK_PICST | Riboflavin kinase OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=FMN1 PE=3 SV=2 | 4 | 171 | 7.0E-41 |
| sp|A5E1A0|RIFK_LODEL | Riboflavin kinase OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=FMN1 PE=3 SV=1 | 4 | 165 | 3.0E-40 |
| sp|A5DAH9|RIFK_PICGU | Riboflavin kinase OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=FMN1 PE=3 SV=2 | 3 | 167 | 3.0E-35 |
| sp|Q6CT57|RIFK_KLULA | Riboflavin kinase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=FMN1 PE=3 SV=1 | 7 | 171 | 1.0E-34 |
| sp|Q6FM49|RIFK_CANGA | Riboflavin kinase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=FMN1 PE=3 SV=2 | 1 | 176 | 2.0E-34 |
| sp|Q6CG11|RIFK_YARLI | Riboflavin kinase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=FMN1 PE=3 SV=1 | 19 | 165 | 8.0E-34 |
| sp|Q03778|RIFK_YEAST | Riboflavin kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FMN1 PE=1 SV=1 | 13 | 166 | 6.0E-33 |
| sp|Q75DY2|RIFK_ASHGO | Riboflavin kinase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=FMN1 PE=3 SV=2 | 3 | 165 | 2.0E-32 |
| sp|Q969G6|RIFK_HUMAN | Riboflavin kinase OS=Homo sapiens GN=RFK PE=1 SV=2 | 18 | 165 | 1.0E-30 |
| sp|Q8CFV9|RIFK_MOUSE | Riboflavin kinase OS=Mus musculus GN=Rfk PE=1 SV=2 | 20 | 165 | 5.0E-30 |
| sp|Q84MD8|FHYRK_ARATH | Bifunctional riboflavin kinase/FMN phosphatase OS=Arabidopsis thaliana GN=FHY PE=1 SV=1 | 17 | 165 | 8.0E-29 |
| sp|O76206|RIFK_DROME | Putative riboflavin kinase OS=Drosophila melanogaster GN=anon-84Ea PE=2 SV=1 | 20 | 165 | 2.0E-27 |
| sp|Q59263|RIBF_CORAM | Riboflavin biosynthesis protein RibF OS=Corynebacterium ammoniagenes GN=ribF PE=1 SV=1 | 23 | 168 | 4.0E-10 |
| sp|P73651|RIBF_SYNY3 | Riboflavin biosynthesis protein RibF OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ribF PE=3 SV=1 | 18 | 172 | 7.0E-09 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0008531 | riboflavin kinase activity | Yes |
| GO:0009231 | riboflavin biosynthetic process | Yes |
| GO:0008150 | biological_process | No |
| GO:0016773 | phosphotransferase activity, alcohol group as acceptor | No |
| GO:0006766 | vitamin metabolic process | No |
| GO:0071704 | organic substance metabolic process | No |
| GO:0006807 | nitrogen compound metabolic process | No |
| GO:0017144 | drug metabolic process | No |
| GO:0008152 | metabolic process | No |
| GO:0042727 | flavin-containing compound biosynthetic process | No |
| GO:0009110 | vitamin biosynthetic process | No |
| GO:0016301 | kinase activity | No |
| GO:0046483 | heterocycle metabolic process | No |
| GO:0042726 | flavin-containing compound metabolic process | No |
| GO:0006771 | riboflavin metabolic process | No |
| GO:0016740 | transferase activity | No |
| GO:0003674 | molecular_function | No |
| GO:0016772 | transferase activity, transferring phosphorus-containing groups | No |
| GO:0009058 | biosynthetic process | No |
| GO:1901564 | organonitrogen compound metabolic process | No |
| GO:0044281 | small molecule metabolic process | No |
| GO:0042364 | water-soluble vitamin biosynthetic process | No |
| GO:0018130 | heterocycle biosynthetic process | No |
| GO:1901362 | organic cyclic compound biosynthetic process | No |
| GO:0003824 | catalytic activity | No |
| GO:0044249 | cellular biosynthetic process | No |
| GO:0044271 | cellular nitrogen compound biosynthetic process | No |
| GO:0044283 | small molecule biosynthetic process | No |
| GO:0006767 | water-soluble vitamin metabolic process | No |
| GO:1901566 | organonitrogen compound biosynthetic process | No |
| GO:1901576 | organic substance biosynthetic process | No |
| GO:1901360 | organic cyclic compound metabolic process | No |
| GO:0034641 | cellular nitrogen compound metabolic process | No |
| GO:0044237 | cellular metabolic process | No |
| GO:0009987 | cellular process | No |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 12 | 0.45 |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >Hirsu2|10296 MSASRPDVVGPEAGPEPPYPLRMEGKVISGFGRGSKELGIPTANLPVDASLTPWITDTPSGVYCGYASLALPAGH PDASTGAGDPGPAGRFAVFPMVMSIGYNPFYKNTVRSAEVHVLHPFAADFYGAHMRLLLLAFIREEKDYSSLEAL VQDINLDCDVARKSLARDGWKPQAASPQDADWLVRPL* |
| Coding | >Hirsu2|10296 ATGTCTGCTTCCCGGCCCGACGTCGTCGGTCCTGAGGCCGGGCCCGAGCCTCCGTACCCGCTGCGGATGGAGGGC AAGGTCATTTCCGGCTTCGGCCGCGGTTCCAAGGAGCTCGGCATCCCCACCGCGAATCTCCCCGTCGACGCCTCC CTCACGCCCTGGATCACCGACACGCCCTCGGGCGTCTACTGCGGCTACGCCTCCCTCGCCCTGCCCGCCGGCCAT CCGGATGCCTCCACGGGCGCCGGCGACCCCGGCCCCGCCGGCCGCTTCGCCGTCTTCCCCATGGTCATGTCCATC GGCTACAACCCGTTCTACAAGAACACGGTCCGCAGCGCCGAGGTCCACGTCCTCCACCCCTTCGCCGCCGACTTC TACGGCGCCCACATGCGCCTCCTCCTTCTCGCCTTCATTCGCGAGGAGAAGGACTACAGCAGCCTCGAGGCCCTC GTCCAGGACATCAACCTCGACTGCGACGTTGCCCGCAAGAGCTTGGCGAGGGACGGCTGGAAGCCCCAGGCAGCT TCGCCCCAAGACGCCGACTGGCTCGTCCGGCCCTTGTAA |
| Transcript | >Hirsu2|10296 ATGTCTGCTTCCCGGCCCGACGTCGTCGGTCCTGAGGCCGGGCCCGAGCCTCCGTACCCGCTGCGGATGGAGGGC AAGGTCATTTCCGGCTTCGGCCGCGGTTCCAAGGAGCTCGGCATCCCCACCGCGAATCTCCCCGTCGACGCCTCC CTCACGCCCTGGATCACCGACACGCCCTCGGGCGTCTACTGCGGCTACGCCTCCCTCGCCCTGCCCGCCGGCCAT CCGGATGCCTCCACGGGCGCCGGCGACCCCGGCCCCGCCGGCCGCTTCGCCGTCTTCCCCATGGTCATGTCCATC GGCTACAACCCGTTCTACAAGAACACGGTCCGCAGCGCCGAGGTCCACGTCCTCCACCCCTTCGCCGCCGACTTC TACGGCGCCCACATGCGCCTCCTCCTTCTCGCCTTCATTCGCGAGGAGAAGGACTACAGCAGCCTCGAGGCCCTC GTCCAGGACATCAACCTCGACTGCGACGTTGCCCGCAAGAGCTTGGCGAGGGACGGCTGGAAGCCCCAGGCAGCT TCGCCCCAAGACGCCGACTGGCTCGTCCGGCCCTTGTAA |
| Gene | >Hirsu2|10296 ATGTCTGCTTCCCGGCCCGACGTCGTCGGTCCTGAGGCCGGGCCCGAGCCTCCGTACCCGCTGCGGATGGAGGGC AAGGTCATTTCCGGCTTCGGCCGCGGTTCCAAGGAGGTGAGCCTCGTCCCCTCCCCCGATTATTCACCCTTCATC CCGCTCCGACGCTCCCCCTCTTCCCTATCCGTCACGTAAAGGAGAAGAAAACAAGGACAAACATATGAATAAACG GCCTCCCTTGCCCCCCCCTCCCCTTCTATAGCTCGGCATCCCCACCGCGAATCTCCCCGTCGACGCCTCCCTCAC GCCCTGGATCACCGACACGCCCTCGGGCGTCTACTGCGGCTACGCCTCCCTCGCCCTGCCCGCCGGCCATCCGGA TGCCTCCACGGGCGCCGGCGACCCCGGCCCCGCCGGCCGCTTCGCCGTCTTCCCCATGGTCATGTCCATCGGCTA CAACCCGTTCTACAAGAACACGGTCCGCAGCGCCGAGGTCCACGTCCTCCACCCCTTCGCCGCCGACTTCTACGG CGCCCACATGCGCCTCCTCCTTCTCGCCTTCATTCGCGAGGAGAAGGACTACAGCAGCCTCGAGGCCCTCGTCCA GGACATCAACCTCGACTGCGACGTTGCCCGCAAGAGCTTGGCGAGGGACGGCTGGAAGCCCCAGGCAGCTTCGCC CCAAGACGCCGACTGGCTCGTCCGGCCCTTGTAA |