Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10296
Gene name
LocationContig_819:825..1534
Strand+
Gene length (bp)709
Transcript length (bp)564
Coding sequence length (bp)564
Protein length (aa) 188

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01687 Flavokinase Riboflavin kinase 8.6E-36 19 165

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0C5D9|RIFK_CHAGB Riboflavin kinase OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=FMN1 PE=3 SV=1 4 186 1.0E-77
sp|A4QQ05|RIFK_MAGO7 Riboflavin kinase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=FMN1 PE=3 SV=3 1 186 2.0E-70
sp|Q6M923|RIFK_NEUCR Riboflavin kinase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fmn1 PE=3 SV=2 4 171 5.0E-67
sp|A1C603|RIFK_ASPCL Riboflavin kinase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=fmn1 PE=3 SV=1 5 184 3.0E-47
sp|Q0CHR1|RIFK_ASPTN Riboflavin kinase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=fmn1 PE=3 SV=1 3 170 2.0E-46
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0C5D9|RIFK_CHAGB Riboflavin kinase OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=FMN1 PE=3 SV=1 4 186 1.0E-77
sp|A4QQ05|RIFK_MAGO7 Riboflavin kinase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=FMN1 PE=3 SV=3 1 186 2.0E-70
sp|Q6M923|RIFK_NEUCR Riboflavin kinase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fmn1 PE=3 SV=2 4 171 5.0E-67
sp|A1C603|RIFK_ASPCL Riboflavin kinase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=fmn1 PE=3 SV=1 5 184 3.0E-47
sp|Q0CHR1|RIFK_ASPTN Riboflavin kinase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=fmn1 PE=3 SV=1 3 170 2.0E-46
sp|Q5AW61|RIFK_EMENI Riboflavin kinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=fmn1 PE=3 SV=1 2 183 4.0E-46
sp|Q2UMM4|RIFK_ASPOR Riboflavin kinase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=fmn1 PE=3 SV=1 5 170 2.0E-45
sp|Q4WHD2|RIFK_ASPFU Riboflavin kinase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=fmn1 PE=3 SV=1 5 170 3.0E-44
sp|A1DG00|RIFK_NEOFI Riboflavin kinase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=fmn1 PE=3 SV=1 5 170 8.0E-43
sp|A2QFH1|RIFK_ASPNC Riboflavin kinase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=fmn1 PE=3 SV=1 5 171 2.0E-42
sp|O74866|RIFK_SCHPO Riboflavin kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fmn1 PE=1 SV=1 1 177 3.0E-42
sp|A3M0C9|RIFK_PICST Riboflavin kinase OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=FMN1 PE=3 SV=2 4 171 7.0E-41
sp|A5E1A0|RIFK_LODEL Riboflavin kinase OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=FMN1 PE=3 SV=1 4 165 3.0E-40
sp|A5DAH9|RIFK_PICGU Riboflavin kinase OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=FMN1 PE=3 SV=2 3 167 3.0E-35
sp|Q6CT57|RIFK_KLULA Riboflavin kinase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=FMN1 PE=3 SV=1 7 171 1.0E-34
sp|Q6FM49|RIFK_CANGA Riboflavin kinase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=FMN1 PE=3 SV=2 1 176 2.0E-34
sp|Q6CG11|RIFK_YARLI Riboflavin kinase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=FMN1 PE=3 SV=1 19 165 8.0E-34
sp|Q03778|RIFK_YEAST Riboflavin kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FMN1 PE=1 SV=1 13 166 6.0E-33
sp|Q75DY2|RIFK_ASHGO Riboflavin kinase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=FMN1 PE=3 SV=2 3 165 2.0E-32
sp|Q969G6|RIFK_HUMAN Riboflavin kinase OS=Homo sapiens GN=RFK PE=1 SV=2 18 165 1.0E-30
sp|Q8CFV9|RIFK_MOUSE Riboflavin kinase OS=Mus musculus GN=Rfk PE=1 SV=2 20 165 5.0E-30
sp|Q84MD8|FHYRK_ARATH Bifunctional riboflavin kinase/FMN phosphatase OS=Arabidopsis thaliana GN=FHY PE=1 SV=1 17 165 8.0E-29
sp|O76206|RIFK_DROME Putative riboflavin kinase OS=Drosophila melanogaster GN=anon-84Ea PE=2 SV=1 20 165 2.0E-27
sp|Q59263|RIBF_CORAM Riboflavin biosynthesis protein RibF OS=Corynebacterium ammoniagenes GN=ribF PE=1 SV=1 23 168 4.0E-10
sp|P73651|RIBF_SYNY3 Riboflavin biosynthesis protein RibF OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ribF PE=3 SV=1 18 172 7.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0008531 riboflavin kinase activity Yes
GO:0009231 riboflavin biosynthetic process Yes
GO:0008150 biological_process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0006766 vitamin metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0017144 drug metabolic process No
GO:0008152 metabolic process No
GO:0042727 flavin-containing compound biosynthetic process No
GO:0009110 vitamin biosynthetic process No
GO:0016301 kinase activity No
GO:0046483 heterocycle metabolic process No
GO:0042726 flavin-containing compound metabolic process No
GO:0006771 riboflavin metabolic process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0009058 biosynthetic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0044281 small molecule metabolic process No
GO:0042364 water-soluble vitamin biosynthetic process No
GO:0018130 heterocycle biosynthetic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0003824 catalytic activity No
GO:0044249 cellular biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0044283 small molecule biosynthetic process No
GO:0006767 water-soluble vitamin metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10296
MSASRPDVVGPEAGPEPPYPLRMEGKVISGFGRGSKELGIPTANLPVDASLTPWITDTPSGVYCGYASLALPAGH
PDASTGAGDPGPAGRFAVFPMVMSIGYNPFYKNTVRSAEVHVLHPFAADFYGAHMRLLLLAFIREEKDYSSLEAL
VQDINLDCDVARKSLARDGWKPQAASPQDADWLVRPL*
Coding >Hirsu2|10296
ATGTCTGCTTCCCGGCCCGACGTCGTCGGTCCTGAGGCCGGGCCCGAGCCTCCGTACCCGCTGCGGATGGAGGGC
AAGGTCATTTCCGGCTTCGGCCGCGGTTCCAAGGAGCTCGGCATCCCCACCGCGAATCTCCCCGTCGACGCCTCC
CTCACGCCCTGGATCACCGACACGCCCTCGGGCGTCTACTGCGGCTACGCCTCCCTCGCCCTGCCCGCCGGCCAT
CCGGATGCCTCCACGGGCGCCGGCGACCCCGGCCCCGCCGGCCGCTTCGCCGTCTTCCCCATGGTCATGTCCATC
GGCTACAACCCGTTCTACAAGAACACGGTCCGCAGCGCCGAGGTCCACGTCCTCCACCCCTTCGCCGCCGACTTC
TACGGCGCCCACATGCGCCTCCTCCTTCTCGCCTTCATTCGCGAGGAGAAGGACTACAGCAGCCTCGAGGCCCTC
GTCCAGGACATCAACCTCGACTGCGACGTTGCCCGCAAGAGCTTGGCGAGGGACGGCTGGAAGCCCCAGGCAGCT
TCGCCCCAAGACGCCGACTGGCTCGTCCGGCCCTTGTAA
Transcript >Hirsu2|10296
ATGTCTGCTTCCCGGCCCGACGTCGTCGGTCCTGAGGCCGGGCCCGAGCCTCCGTACCCGCTGCGGATGGAGGGC
AAGGTCATTTCCGGCTTCGGCCGCGGTTCCAAGGAGCTCGGCATCCCCACCGCGAATCTCCCCGTCGACGCCTCC
CTCACGCCCTGGATCACCGACACGCCCTCGGGCGTCTACTGCGGCTACGCCTCCCTCGCCCTGCCCGCCGGCCAT
CCGGATGCCTCCACGGGCGCCGGCGACCCCGGCCCCGCCGGCCGCTTCGCCGTCTTCCCCATGGTCATGTCCATC
GGCTACAACCCGTTCTACAAGAACACGGTCCGCAGCGCCGAGGTCCACGTCCTCCACCCCTTCGCCGCCGACTTC
TACGGCGCCCACATGCGCCTCCTCCTTCTCGCCTTCATTCGCGAGGAGAAGGACTACAGCAGCCTCGAGGCCCTC
GTCCAGGACATCAACCTCGACTGCGACGTTGCCCGCAAGAGCTTGGCGAGGGACGGCTGGAAGCCCCAGGCAGCT
TCGCCCCAAGACGCCGACTGGCTCGTCCGGCCCTTGTAA
Gene >Hirsu2|10296
ATGTCTGCTTCCCGGCCCGACGTCGTCGGTCCTGAGGCCGGGCCCGAGCCTCCGTACCCGCTGCGGATGGAGGGC
AAGGTCATTTCCGGCTTCGGCCGCGGTTCCAAGGAGGTGAGCCTCGTCCCCTCCCCCGATTATTCACCCTTCATC
CCGCTCCGACGCTCCCCCTCTTCCCTATCCGTCACGTAAAGGAGAAGAAAACAAGGACAAACATATGAATAAACG
GCCTCCCTTGCCCCCCCCTCCCCTTCTATAGCTCGGCATCCCCACCGCGAATCTCCCCGTCGACGCCTCCCTCAC
GCCCTGGATCACCGACACGCCCTCGGGCGTCTACTGCGGCTACGCCTCCCTCGCCCTGCCCGCCGGCCATCCGGA
TGCCTCCACGGGCGCCGGCGACCCCGGCCCCGCCGGCCGCTTCGCCGTCTTCCCCATGGTCATGTCCATCGGCTA
CAACCCGTTCTACAAGAACACGGTCCGCAGCGCCGAGGTCCACGTCCTCCACCCCTTCGCCGCCGACTTCTACGG
CGCCCACATGCGCCTCCTCCTTCTCGCCTTCATTCGCGAGGAGAAGGACTACAGCAGCCTCGAGGCCCTCGTCCA
GGACATCAACCTCGACTGCGACGTTGCCCGCAAGAGCTTGGCGAGGGACGGCTGGAAGCCCCAGGCAGCTTCGCC
CCAAGACGCCGACTGGCTCGTCCGGCCCTTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail