Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10292
Gene name
LocationContig_817:10479..11742
Strand+
Gene length (bp)1263
Transcript length (bp)1155
Coding sequence length (bp)1155
Protein length (aa) 385

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01593 Amino_oxidase Flavin containing amine oxidoreductase 1.6E-16 72 377
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 7.7E-11 67 132
PF01266 DAO FAD dependent oxidoreductase 5.7E-07 65 102

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10062|PPOX_SCHPO Protoporphyrinogen oxidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hem14 PE=3 SV=1 65 378 9.0E-22
sp|P32397|PPOX_BACSU Protoporphyrinogen oxidase OS=Bacillus subtilis (strain 168) GN=hemY PE=1 SV=1 64 261 1.0E-13
sp|P40012|PPOX_YEAST Protoporphyrinogen oxidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HEM14 PE=1 SV=1 75 356 6.0E-12
sp|Q54DT8|PPOX_DICDI Protoporphyrinogen oxidase OS=Dictyostelium discoideum GN=ppox PE=3 SV=1 64 379 1.0E-11
sp|P50336|PPOX_HUMAN Protoporphyrinogen oxidase OS=Homo sapiens GN=PPOX PE=1 SV=1 65 265 3.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10062|PPOX_SCHPO Protoporphyrinogen oxidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hem14 PE=3 SV=1 65 378 9.0E-22
sp|P32397|PPOX_BACSU Protoporphyrinogen oxidase OS=Bacillus subtilis (strain 168) GN=hemY PE=1 SV=1 64 261 1.0E-13
sp|P40012|PPOX_YEAST Protoporphyrinogen oxidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HEM14 PE=1 SV=1 75 356 6.0E-12
sp|Q54DT8|PPOX_DICDI Protoporphyrinogen oxidase OS=Dictyostelium discoideum GN=ppox PE=3 SV=1 64 379 1.0E-11
sp|P50336|PPOX_HUMAN Protoporphyrinogen oxidase OS=Homo sapiens GN=PPOX PE=1 SV=1 65 265 3.0E-11
sp|Q60HD5|PPOX_MACFA Protoporphyrinogen oxidase OS=Macaca fascicularis GN=PPOX PE=2 SV=1 65 265 6.0E-11
sp|P56602|PPOX_BOVIN Protoporphyrinogen oxidase OS=Bos taurus GN=PPOX PE=1 SV=2 65 265 1.0E-10
sp|P51175|PPOX_MOUSE Protoporphyrinogen oxidase OS=Mus musculus GN=Ppox PE=1 SV=1 65 265 6.0E-10
sp|Q8S9J1|PPOCM_ARATH Protoporphyrinogen oxidase 2, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=PPOX2 PE=1 SV=1 64 372 3.0E-09
sp|O24163|PPOC_TOBAC Protoporphyrinogen oxidase, chloroplastic OS=Nicotiana tabacum GN=PPXI PE=2 SV=1 60 335 6.0E-09
sp|Q9AR38|PPOC_ORYSJ Protoporphyrinogen oxidase, chloroplastic OS=Oryza sativa subsp. japonica GN=PPOX1 PE=2 SV=1 63 335 1.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0055114 oxidation-reduction process Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10292
MGCRRAEDVSVRALLRLAATGSTAAATRPRLGDSIRRAALPLDDPASVAGRRVRTYATTAEDARIAVIGGGLTGL
TAAYYLAKQVPRTTKIVLYEASDRLGGWIKTDWVKVKMWGDELELKFERGPRTLSSLRKSLGRFDDLVLYDLALD
LGLQLSAPPDRPRYILYGGRPVLLPPDAPLGRFVREPLFLDTVGAVAGAVLRRLVRSDMPAEDLSVSDWLRKIWM
GPAVADNLVSAMVHGIYGGDIDKLSARSVLGRMYTSYYQAMGKPKPGFVSLTRREHDLLAAMSRDPLIRERAQLP
KGQLLHFGPLGMETLPTMLADALGKQPNVELRTSSKVGAISFHPRQHKVSLLATGGKDGSGSDESYDRVISTTDS
KQLCTPSRS*
Coding >Hirsu2|10292
ATGGGCTGCAGGCGCGCAGAGGATGTCTCCGTACGTGCCCTGCTTCGGCTCGCGGCGACGGGCAGCACAGCAGCG
GCGACGCGGCCGCGTCTCGGCGACTCCATCCGGCGGGCGGCTCTGCCTCTCGACGATCCGGCCAGCGTCGCCGGC
CGCCGCGTCCGGACGTACGCGACGACGGCCGAGGACGCGCGCATCGCCGTCATCGGCGGAGGGCTGACGGGCCTA
ACGGCGGCCTACTACCTGGCCAAGCAGGTGCCGCGGACGACCAAGATCGTGCTGTACGAGGCCAGCGACCGGCTG
GGCGGCTGGATCAAGACGGACTGGGTCAAGGTCAAGATGTGGGGTGACGAACTGGAGCTCAAGTTCGAGCGCGGA
CCGCGGACGCTGTCGTCGCTGCGCAAGAGCCTCGGCCGCTTCGACGACCTGGTGCTCTACGACCTGGCGCTGGAC
CTCGGCCTCCAGCTGTCGGCGCCGCCGGACCGGCCGCGCTACATCCTGTACGGCGGCCGCCCCGTGCTGCTGCCG
CCGGACGCGCCGCTCGGCCGCTTCGTGCGCGAGCCGCTCTTCCTCGACACCGTCGGCGCCGTCGCCGGCGCCGTC
CTGCGCCGGCTCGTGCGCAGCGACATGCCGGCCGAGGACCTGTCCGTCTCCGACTGGCTGCGCAAGATCTGGATG
GGGCCGGCCGTGGCCGACAACCTCGTCTCGGCCATGGTCCACGGCATCTACGGCGGCGACATCGACAAGCTCAGC
GCCCGCTCCGTCCTCGGCCGCATGTACACCAGCTACTACCAGGCCATGGGGAAGCCGAAGCCCGGCTTCGTCAGC
CTGACGCGCCGCGAACACGACCTGTTGGCGGCCATGTCGCGCGATCCGCTCATCCGCGAGAGGGCCCAGCTGCCC
AAGGGCCAGCTGCTGCACTTCGGCCCCCTGGGCATGGAAACCCTGCCGACGATGCTGGCCGACGCGCTGGGAAAG
CAGCCCAACGTCGAGCTCCGGACCTCCAGCAAGGTCGGCGCCATCAGCTTCCACCCGAGGCAGCACAAGGTCTCC
CTCCTGGCGACGGGCGGCAAGGACGGGAGCGGCAGCGACGAGAGCTACGACCGCGTCATCTCCACCACCGACAGC
AAGCAGCTATGCACTCCGTCTCGATCATGA
Transcript >Hirsu2|10292
ATGGGCTGCAGGCGCGCAGAGGATGTCTCCGTACGTGCCCTGCTTCGGCTCGCGGCGACGGGCAGCACAGCAGCG
GCGACGCGGCCGCGTCTCGGCGACTCCATCCGGCGGGCGGCTCTGCCTCTCGACGATCCGGCCAGCGTCGCCGGC
CGCCGCGTCCGGACGTACGCGACGACGGCCGAGGACGCGCGCATCGCCGTCATCGGCGGAGGGCTGACGGGCCTA
ACGGCGGCCTACTACCTGGCCAAGCAGGTGCCGCGGACGACCAAGATCGTGCTGTACGAGGCCAGCGACCGGCTG
GGCGGCTGGATCAAGACGGACTGGGTCAAGGTCAAGATGTGGGGTGACGAACTGGAGCTCAAGTTCGAGCGCGGA
CCGCGGACGCTGTCGTCGCTGCGCAAGAGCCTCGGCCGCTTCGACGACCTGGTGCTCTACGACCTGGCGCTGGAC
CTCGGCCTCCAGCTGTCGGCGCCGCCGGACCGGCCGCGCTACATCCTGTACGGCGGCCGCCCCGTGCTGCTGCCG
CCGGACGCGCCGCTCGGCCGCTTCGTGCGCGAGCCGCTCTTCCTCGACACCGTCGGCGCCGTCGCCGGCGCCGTC
CTGCGCCGGCTCGTGCGCAGCGACATGCCGGCCGAGGACCTGTCCGTCTCCGACTGGCTGCGCAAGATCTGGATG
GGGCCGGCCGTGGCCGACAACCTCGTCTCGGCCATGGTCCACGGCATCTACGGCGGCGACATCGACAAGCTCAGC
GCCCGCTCCGTCCTCGGCCGCATGTACACCAGCTACTACCAGGCCATGGGGAAGCCGAAGCCCGGCTTCGTCAGC
CTGACGCGCCGCGAACACGACCTGTTGGCGGCCATGTCGCGCGATCCGCTCATCCGCGAGAGGGCCCAGCTGCCC
AAGGGCCAGCTGCTGCACTTCGGCCCCCTGGGCATGGAAACCCTGCCGACGATGCTGGCCGACGCGCTGGGAAAG
CAGCCCAACGTCGAGCTCCGGACCTCCAGCAAGGTCGGCGCCATCAGCTTCCACCCGAGGCAGCACAAGGTCTCC
CTCCTGGCGACGGGCGGCAAGGACGGGAGCGGCAGCGACGAGAGCTACGACCGCGTCATCTCCACCACCGACAGC
AAGCAGCTATGCACTCCGTCTCGATCATGA
Gene >Hirsu2|10292
ATGGGCTGCAGGCGCGCAGAGGATGTCTCCGTACGTGCCCTGCTTCGGCTCGCGGCGACGGGCAGCACAGCAGCG
GCGACGCGGCCGCGTCTCGGCGACTCCATCCGGCGGGCGGCTCTGCCTCTCGACGATCCGGCCAGCGTCGCCGGC
CGCCGCGTCCGGACGTACGCGACGACGGCCGAGGACGCGCGCATCGCCGTCATCGGCGGAGGGCTGACGGGCCTA
ACGGCGGCCTACTACCTGGCCAAGCAGGTGCCGCGGACGACCAAGATCGTGCTGTACGAGGCCAGCGACCGGCTG
GGCGGCTGGATCAAGACGGACTGGGTCAAGGTCAAGATGTGGGGTGACGAACTGGAGCTCAAGTTCGAGCGCGGA
CCGCGGACGCTGTCGTCGCTGCGCAAGAGCCTCGGCCGCTTCGACGACCTGGTGCTCTACGACCTGGCGCTGGAC
CTCGGCCTCCAGCTGTCGGCGCCGCCGGACCGGCCGCGCTACATCCTGTACGGCGGCCGCCCCGTGCTGCTGCCG
CCGGACGCGCCGCTCGGCCGCTTCGTGCGCGAGCCGCTCTTCCTCGACACCGTCGGCGCCGTCGCCGGCGCCGTC
CTGCGCCGGCTCGTGCGCAGCGACATGCCGGCCGAGGACCTGTCCGTCTCCGACTGGCTGCGCAAGATCTGGATG
GGGCCGGCCGTGGCCGACAACCTCGTCTCGGCCATGGTCCACGGCATCTACGGCGGCGACATCGACAAGCTCAGC
GCCCGCTCCGTCCTCGGCCGCATGTACACCAGCTACTACCAGGCCATGGGGAAGCCGAAGCCCGGCTTCGTCAGC
CTGACGCGCCGCGAACACGACCTGTTGGCGGCCATGTCGCGCGATCCGCTCATCCGCGAGAGGGCCCAGCTGCCC
AAGGGCCAGCTGCTGCACTTCGGCCCCCTGGGCATGGAAACCCTGCCGACGATGCTGGCCGACGCGCTGGGAAAG
CAGCCCAACGTCGAGCTCCGGACCTCCAGCAAGGTCGGCGCCATCAGCTTCCACCCGAGGCAGCACAAGGTCTCC
GTGAGTTGTTTGCCCGCCCGTCCGCCCTCCCCCTTCCCCTCTTCGCTGACGTCGATCGAAACAACAAGCTCCTGG
CGACGGGCGGCAAGGACGGGAGCGGCAGCGACGAGAGCTACGACCGCGTCATCTCCACCACCGACAGCAAGCAGC
TGTACGGCGCGACGGCGCACAAGCTCCTGCCGCTGGCCGAGATGCACTCCGTCTCGATCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail