Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10288
Gene name
LocationContig_816:10962..11526
Strand+
Gene length (bp)564
Transcript length (bp)564
Coding sequence length (bp)564
Protein length (aa) 188

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01699 Na_Ca_ex Sodium/calcium exchanger protein 2.2E-15 45 179

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q99385|VCX1_YEAST Vacuolar calcium ion transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VCX1 PE=1 SV=1 19 181 2.0E-36
sp|O59768|VCX1_SCHPO Vacuolar calcium ion transporter OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vcx1 PE=3 SV=1 20 178 2.0E-30
sp|Q75XW3|CAX_APHHA Ca(2+)/H(+) antiporter OS=Aphanothece halophytica PE=1 SV=1 48 182 4.0E-27
sp|P74072|CAX_SYNY3 Ca(2+)/H(+) antiporter OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr1336 PE=1 SV=1 48 179 3.0E-25
sp|Q39254|CAX2_ARATH Vacuolar cation/proton exchanger 2 OS=Arabidopsis thaliana GN=CAX2 PE=1 SV=2 32 177 1.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q99385|VCX1_YEAST Vacuolar calcium ion transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VCX1 PE=1 SV=1 19 181 2.0E-36
sp|O59768|VCX1_SCHPO Vacuolar calcium ion transporter OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vcx1 PE=3 SV=1 20 178 2.0E-30
sp|Q75XW3|CAX_APHHA Ca(2+)/H(+) antiporter OS=Aphanothece halophytica PE=1 SV=1 48 182 4.0E-27
sp|P74072|CAX_SYNY3 Ca(2+)/H(+) antiporter OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr1336 PE=1 SV=1 48 179 3.0E-25
sp|Q39254|CAX2_ARATH Vacuolar cation/proton exchanger 2 OS=Arabidopsis thaliana GN=CAX2 PE=1 SV=2 32 177 1.0E-23
sp|Q6K1C4|CAX3_ORYSJ Vacuolar cation/proton exchanger 3 OS=Oryza sativa subsp. japonica GN=CAX3 PE=2 SV=2 45 177 4.0E-23
sp|Q5KQN0|CAX2_ORYSJ Vacuolar cation/proton exchanger 2 OS=Oryza sativa subsp. japonica GN=CAX2 PE=2 SV=2 46 177 8.0E-23
sp|Q8L783|CAX5_ARATH Vacuolar cation/proton exchanger 5 OS=Arabidopsis thaliana GN=CAX5 PE=2 SV=1 31 177 2.0E-22
sp|Q945S5|CAX4_ARATH Vacuolar cation/proton exchanger 4 OS=Arabidopsis thaliana GN=CAX4 PE=1 SV=2 30 177 2.0E-21
sp|Q9LFZ8|CAX6_ARATH Putative vacuolar cation/proton exchanger 6 OS=Arabidopsis thaliana GN=CAX6 PE=3 SV=3 8 177 1.0E-20
sp|Q93Z81|CAX3_ARATH Vacuolar cation/proton exchanger 3 OS=Arabidopsis thaliana GN=CAX3 PE=1 SV=1 49 177 2.0E-19
sp|Q769E5|CAX1A_ORYSJ Vacuolar cation/proton exchanger 1a OS=Oryza sativa subsp. japonica GN=CAX1a PE=1 SV=1 19 177 3.0E-19
sp|Q39253|CAX1_ARATH Vacuolar cation/proton exchanger 1 OS=Arabidopsis thaliana GN=CAX1 PE=1 SV=3 20 177 6.0E-19
sp|Q6YXZ1|CAX4_ORYSJ Putative vacuolar cation/proton exchanger 4 OS=Oryza sativa subsp. japonica GN=Os02g0138900 PE=3 SV=1 31 176 1.0E-17
sp|O34840|CHAA_BACSU Ca(2+)/H(+) antiporter ChaA OS=Bacillus subtilis (strain 168) GN=chaA PE=1 SV=1 19 181 2.0E-16
sp|Q5TKG3|CAX1B_ORYSJ Vacuolar cation/proton exchanger 1b OS=Oryza sativa subsp. japonica GN=CAX1b PE=2 SV=1 60 177 2.0E-15
sp|Q5KTQ9|CAX1C_ORYSJ Vacuolar cation/proton exchanger 1c OS=Oryza sativa subsp. japonica GN=CAX1c PE=2 SV=1 57 177 4.0E-12
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0016021 integral component of membrane Yes
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

Domain # Start End Length
1 79 101 22
2 114 136 22
3 146 163 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10288
LSFCLRLCVLATIFRTQGYFQSVTHADFFVDDSQEADHELDAVSSCVVLVLSTLGVATCSDRLVDSIDGFVKALG
LSRSFVGLIIVPIVGNLGCFVGTVEWPRANRIQLAISVIVSSTLQISLFVTPLLVVVGWVIDQKMSLQFDTFQTT
VLTISTLVVNCLVRDGETNYFEGVLLVATCVCPCALA*
Coding >Hirsu2|10288
CTGTCTTTCTGCTTGCGCCTTTGCGTGTTGGCAACCATCTTCCGTACCCAAGGTTACTTCCAGTCCGTGACGCAC
GCCGACTTCTTCGTCGACGACAGCCAAGAGGCCGACCACGAGCTGGATGCGGTGTCCAGCTGCGTCGTCCTCGTC
CTTTCCACGCTCGGCGTCGCCACCTGCTCAGATCGCCTGGTCGACAGCATCGACGGCTTCGTCAAGGCGCTGGGC
CTAAGCCGTAGCTTTGTCGGGCTCATAATCGTGCCCATCGTCGGCAACCTGGGCTGTTTCGTCGGCACCGTCGAG
TGGCCCAGGGCCAACCGCATACAGCTGGCCATATCCGTCATCGTGAGCAGCACGCTGCAGATCTCGCTCTTCGTC
ACGCCCTTGCTCGTCGTCGTCGGCTGGGTCATCGACCAGAAGATGTCGCTACAGTTCGACACGTTCCAGACGACT
GTCCTGACCATATCCACTCTCGTCGTCAACTGTCTGGTGCGAGATGGAGAAACGAACTACTTCGAGGGCGTTCTC
CTGGTCGCTACGTGCGTGTGTCCCTGCGCTCTTGCATAG
Transcript >Hirsu2|10288
CTGTCTTTCTGCTTGCGCCTTTGCGTGTTGGCAACCATCTTCCGTACCCAAGGTTACTTCCAGTCCGTGACGCAC
GCCGACTTCTTCGTCGACGACAGCCAAGAGGCCGACCACGAGCTGGATGCGGTGTCCAGCTGCGTCGTCCTCGTC
CTTTCCACGCTCGGCGTCGCCACCTGCTCAGATCGCCTGGTCGACAGCATCGACGGCTTCGTCAAGGCGCTGGGC
CTAAGCCGTAGCTTTGTCGGGCTCATAATCGTGCCCATCGTCGGCAACCTGGGCTGTTTCGTCGGCACCGTCGAG
TGGCCCAGGGCCAACCGCATACAGCTGGCCATATCCGTCATCGTGAGCAGCACGCTGCAGATCTCGCTCTTCGTC
ACGCCCTTGCTCGTCGTCGTCGGCTGGGTCATCGACCAGAAGATGTCGCTACAGTTCGACACGTTCCAGACGACT
GTCCTGACCATATCCACTCTCGTCGTCAACTGTCTGGTGCGAGATGGAGAAACGAACTACTTCGAGGGCGTTCTC
CTGGTCGCTACGTGCGTGTGTCCCTGCGCTCTTGCATAG
Gene >Hirsu2|10288
CTGTCTTTCTGCTTGCGCCTTTGCGTGTTGGCAACCATCTTCCGTACCCAAGGTTACTTCCAGTCCGTGACGCAC
GCCGACTTCTTCGTCGACGACAGCCAAGAGGCCGACCACGAGCTGGATGCGGTGTCCAGCTGCGTCGTCCTCGTC
CTTTCCACGCTCGGCGTCGCCACCTGCTCAGATCGCCTGGTCGACAGCATCGACGGCTTCGTCAAGGCGCTGGGC
CTAAGCCGTAGCTTTGTCGGGCTCATAATCGTGCCCATCGTCGGCAACCTGGGCTGTTTCGTCGGCACCGTCGAG
TGGCCCAGGGCCAACCGCATACAGCTGGCCATATCCGTCATCGTGAGCAGCACGCTGCAGATCTCGCTCTTCGTC
ACGCCCTTGCTCGTCGTCGTCGGCTGGGTCATCGACCAGAAGATGTCGCTACAGTTCGACACGTTCCAGACGACT
GTCCTGACCATATCCACTCTCGTCGTCAACTGTCTGGTGCGAGATGGAGAAACGAACTACTTCGAGGGCGTTCTC
CTGGTCGCTACGTGCGTGTGTCCCTGCGCTCTTGCATAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail