Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10287
Gene name
LocationContig_816:8450..8789
Strand-
Gene length (bp)339
Transcript length (bp)339
Coding sequence length (bp)339
Protein length (aa) 113

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07727 RVT_2 Reverse transcriptase (RNA-dependent DNA polymerase) 5.0E-12 2 101

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12316|YG13B_YEAST Transposon Ty1-GR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR3 PE=3 SV=3 13 106 7.0E-06
sp|O13535|YH11B_YEAST Transposon Ty1-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-H PE=3 SV=1 13 106 7.0E-06
sp|Q12193|YB12B_YEAST Transposon Ty1-BR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BR PE=3 SV=1 13 106 7.0E-06
sp|P0C2J0|YP13B_YEAST Transposon Ty1-PR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR2 PE=3 SV=1 13 106 7.0E-06
sp|Q03855|YD11B_YEAST Transposon Ty1-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR1 PE=3 SV=2 13 106 7.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12316|YG13B_YEAST Transposon Ty1-GR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR3 PE=3 SV=3 13 106 7.0E-06
sp|O13535|YH11B_YEAST Transposon Ty1-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-H PE=3 SV=1 13 106 7.0E-06
sp|Q12193|YB12B_YEAST Transposon Ty1-BR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BR PE=3 SV=1 13 106 7.0E-06
sp|P0C2J0|YP13B_YEAST Transposon Ty1-PR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR2 PE=3 SV=1 13 106 7.0E-06
sp|Q03855|YD11B_YEAST Transposon Ty1-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR1 PE=3 SV=2 13 106 7.0E-06
sp|Q99231|YD12B_YEAST Transposon Ty1-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR3 PE=1 SV=2 13 106 7.0E-06
sp|P0C2I2|YD14B_YEAST Transposon Ty1-DR5 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR5 PE=3 SV=1 13 106 7.0E-06
sp|Q03612|YE11B_YEAST Transposon Ty1-ER1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER1 PE=3 SV=1 13 106 7.0E-06
sp|Q03619|YE12B_YEAST Transposon Ty1-ER2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER2 PE=3 SV=1 13 106 7.0E-06
sp|Q12269|YG12B_YEAST Transposon Ty1-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR2 PE=3 SV=3 13 106 7.0E-06
sp|O13527|YA11B_YEAST Truncated transposon Ty1-A Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-A PE=3 SV=3 13 106 7.0E-06
sp|Q12088|YL11B_YEAST Transposon Ty1-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR1 PE=3 SV=1 13 106 7.0E-06
sp|P0C2I5|YL12B_YEAST Transposon Ty1-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR2 PE=3 SV=1 13 106 7.0E-06
sp|Q04711|YM11B_YEAST Transposon Ty1-ML1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML1 PE=3 SV=2 13 106 7.0E-06
sp|Q03434|YM12B_YEAST Transposon Ty1-ML2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML2 PE=3 SV=2 13 106 7.0E-06
sp|Q04670|YM14B_YEAST Transposon Ty1-MR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR2 PE=3 SV=2 13 106 7.0E-06
sp|Q12273|YO11B_YEAST Transposon Ty1-OL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OL PE=3 SV=1 13 106 7.0E-06
sp|Q92393|YO12B_YEAST Transposon Ty1-OR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OR PE=3 SV=1 13 106 7.0E-06
sp|Q12414|YP11B_YEAST Transposon Ty1-PL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PL PE=3 SV=1 13 106 7.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10287
MAITAKFDLDTRQLDAVNAFTNALLDEDEEVYVLFPDGYYRQGWVLRLMRALYGLPRSPLLWQKELTSAFKDLGL
KQCPDEPRVFQNDWLTVFFFVDDIVFLYRKDKEGVAD*
Coding >Hirsu2|10287
ATGGCTATTACAGCAAAATTCGACCTTGATACCCGACAGCTCGACGCAGTCAATGCCTTCACCAACGCCCTCCTC
GACGAGGATGAGGAAGTCTATGTGTTATTCCCCGACGGGTACTATAGACAAGGATGGGTCCTTCGCCTCATGCGA
GCCCTCTACGGACTCCCACGGTCCCCTCTTCTGTGGCAGAAGGAACTCACGAGCGCGTTCAAAGACCTTGGTCTC
AAGCAATGCCCCGACGAACCTCGTGTTTTCCAGAACGACTGGCTCACGGTCTTCTTCTTCGTGGACGATATAGTG
TTTCTATATCGTAAAGACAAAGAGGGTGTAGCTGACTAG
Transcript >Hirsu2|10287
ATGGCTATTACAGCAAAATTCGACCTTGATACCCGACAGCTCGACGCAGTCAATGCCTTCACCAACGCCCTCCTC
GACGAGGATGAGGAAGTCTATGTGTTATTCCCCGACGGGTACTATAGACAAGGATGGGTCCTTCGCCTCATGCGA
GCCCTCTACGGACTCCCACGGTCCCCTCTTCTGTGGCAGAAGGAACTCACGAGCGCGTTCAAAGACCTTGGTCTC
AAGCAATGCCCCGACGAACCTCGTGTTTTCCAGAACGACTGGCTCACGGTCTTCTTCTTCGTGGACGATATAGTG
TTTCTATATCGTAAAGACAAAGAGGGTGTAGCTGACTAG
Gene >Hirsu2|10287
ATGGCTATTACAGCAAAATTCGACCTTGATACCCGACAGCTCGACGCAGTCAATGCCTTCACCAACGCCCTCCTC
GACGAGGATGAGGAAGTCTATGTGTTATTCCCCGACGGGTACTATAGACAAGGATGGGTCCTTCGCCTCATGCGA
GCCCTCTACGGACTCCCACGGTCCCCTCTTCTGTGGCAGAAGGAACTCACGAGCGCGTTCAAAGACCTTGGTCTC
AAGCAATGCCCCGACGAACCTCGTGTTTTCCAGAACGACTGGCTCACGGTCTTCTTCTTCGTGGACGATATAGTG
TTTCTATATCGTAAAGACAAAGAGGGTGTAGCTGACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail