Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10285
Gene name
LocationContig_816:6157..6688
Strand+
Gene length (bp)531
Transcript length (bp)477
Coding sequence length (bp)477
Protein length (aa) 159

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.5342 0.5374 0.3044 0.0883 0.3074 0.0387 0.0544 0.1293 0.1599 0.0182

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5983
Change Orthofinder run
Species Protein ID
Ophiocordyceps subramaniannii Hirsu2|10285 (this protein)
Ophiocordyceps subramaniannii Hirsu2|297
Ophiocordyceps subramaniannii Hirsu2|6349
Ophiocordyceps subramaniannii Hirsu2|7735
Ophiocordyceps subramaniannii Hirsu2|8431

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10285
MEPALPRKFGYLRFFLFLECVKAKIGDDKAQGLIPREKSVVNSSRAYSIYVNAQVVVTKQNDLRRNRQMGGRFHQ
ISVESPLLLAVFAKAADMFADPKKVDEPTFAVLASRAREDIPKELRDVCQFLTTKVEEAICSGAPYSQYLGQDMT
NQIREHLT*
Coding >Hirsu2|10285
ATGGAGCCAGCGCTGCCACGAAAATTTGGCTATTTACGATTTTTCCTATTCCTGGAGTGTGTGAAGGCCAAGATT
GGCGACGATAAGGCCCAGGGATTGATTCCCCGTGAAAAGAGTGTCGTCAATAGTTCTCGTGCCTATAGCATATAT
GTCAATGCCCAGGTTGTGGTTACCAAACAGAACGATCTCCGGCGCAACAGGCAAATGGGCGGGCGCTTTCATCAA
ATTTCAGTTGAATCCCCTCTTCTTCTGGCCGTCTTCGCCAAAGCAGCGGACATGTTCGCGGATCCAAAGAAGGTG
GACGAGCCTACTTTCGCAGTTTTGGCCTCCCGAGCTCGTGAGGACATTCCGAAGGAGCTCCGAGACGTCTGTCAG
TTTTTAACCACCAAGGTAGAGGAAGCGATATGTTCAGGGGCCCCTTACAGTCAATATCTGGGGCAGGATATGACG
AATCAAATTAGAGAGCACTTGACCTAG
Transcript >Hirsu2|10285
ATGGAGCCAGCGCTGCCACGAAAATTTGGCTATTTACGATTTTTCCTATTCCTGGAGTGTGTGAAGGCCAAGATT
GGCGACGATAAGGCCCAGGGATTGATTCCCCGTGAAAAGAGTGTCGTCAATAGTTCTCGTGCCTATAGCATATAT
GTCAATGCCCAGGTTGTGGTTACCAAACAGAACGATCTCCGGCGCAACAGGCAAATGGGCGGGCGCTTTCATCAA
ATTTCAGTTGAATCCCCTCTTCTTCTGGCCGTCTTCGCCAAAGCAGCGGACATGTTCGCGGATCCAAAGAAGGTG
GACGAGCCTACTTTCGCAGTTTTGGCCTCCCGAGCTCGTGAGGACATTCCGAAGGAGCTCCGAGACGTCTGTCAG
TTTTTAACCACCAAGGTAGAGGAAGCGATATGTTCAGGGGCCCCTTACAGTCAATATCTGGGGCAGGATATGACG
AATCAAATTAGAGAGCACTTGACCTAG
Gene >Hirsu2|10285
ATGGAGCCAGCGCTGCCACGAAAATTTGGCTATTTACGATTTTTCCTATTCCTGGAGTGTGTGAAGGCCAAGATT
GGCGACGATAAGGCCCAGGGATTGATTCCCCGTGAAAAGAGTGTCGTCAATAGTTCTCGTGCCTATAGCATATAT
GTCAATGCCCAGGTTGTGGTTACCAAACAGAACGATCTCCGGCGCAACAGGCAAATGGGCGGGCGCTTTCATCAA
ATTTCAGTTGAATCCCCTCTTCTTCTGGCCGTCTTCGCCAAAGCAGCGGACATGTTCGCGTACGTACTTGCTGTT
TCGAAACTTTCAACTTTTAGAAAGCTCACCTGCTACAGGGATCCAAAGAAGGTGGACGAGCCTACTTTCGCAGTT
TTGGCCTCCCGAGCTCGTGAGGACATTCCGAAGGAGCTCCGAGACGTCTGTCAGTTTTTAACCACCAAGGTAGAG
GAAGCGATATGTTCAGGGGCCCCTTACAGTCAATATCTGGGGCAGGATATGACGAATCAAATTAGAGAGCACTTG
ACCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail