Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10282
Gene name
LocationContig_815:6952..8620
Strand-
Gene length (bp)1668
Transcript length (bp)1077
Coding sequence length (bp)1077
Protein length (aa) 359

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 5.3E-09 64 221
PF07714 Pkinase_Tyr Protein tyrosine kinase 2.2E-05 34 253

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7JP68|KAPC2_CAEEL cAMP-dependent protein kinase, catalytic subunit-like OS=Caenorhabditis elegans GN=F47F2.1 PE=1 SV=1 75 222 7.0E-09
sp|Q2RBF0|CIPKF_ORYSJ CBL-interacting protein kinase 15 OS=Oryza sativa subsp. japonica GN=CIPK15 PE=2 SV=1 73 227 3.0E-08
sp|Q2QYM3|CIPKE_ORYSJ CBL-interacting protein kinase 14 OS=Oryza sativa subsp. japonica GN=CIPK14 PE=2 SV=1 73 227 3.0E-08
sp|A8XJQ6|KAPC2_CAEBR cAMP-dependent protein kinase, catalytic subunit-like OS=Caenorhabditis briggsae GN=CBG14305 PE=1 SV=2 79 222 5.0E-08
sp|A0AUV4|SMKY_MOUSE Sperm motility kinase Y OS=Mus musculus GN=Gm7168 PE=2 SV=1 44 239 9.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7JP68|KAPC2_CAEEL cAMP-dependent protein kinase, catalytic subunit-like OS=Caenorhabditis elegans GN=F47F2.1 PE=1 SV=1 75 222 7.0E-09
sp|Q2RBF0|CIPKF_ORYSJ CBL-interacting protein kinase 15 OS=Oryza sativa subsp. japonica GN=CIPK15 PE=2 SV=1 73 227 3.0E-08
sp|Q2QYM3|CIPKE_ORYSJ CBL-interacting protein kinase 14 OS=Oryza sativa subsp. japonica GN=CIPK14 PE=2 SV=1 73 227 3.0E-08
sp|A8XJQ6|KAPC2_CAEBR cAMP-dependent protein kinase, catalytic subunit-like OS=Caenorhabditis briggsae GN=CBG14305 PE=1 SV=2 79 222 5.0E-08
sp|A0AUV4|SMKY_MOUSE Sperm motility kinase Y OS=Mus musculus GN=Gm7168 PE=2 SV=1 44 239 9.0E-08
sp|Q8WP15|GRK7_PIG G protein-coupled receptor kinase 7 OS=Sus scrofa GN=GRK7 PE=1 SV=1 56 230 3.0E-07
sp|P31693|SRC_RSVPA Tyrosine-protein kinase transforming protein Src OS=Rous sarcoma virus (strain PA101T) GN=V-SRC PE=3 SV=3 33 250 4.0E-07
sp|Q6ZLP5|CIPKN_ORYSJ CBL-interacting protein kinase 23 OS=Oryza sativa subsp. japonica GN=CIPK23 PE=2 SV=1 29 217 5.0E-07
sp|Q6VZ17|HUNKB_XENLA Hormonally up-regulated neu tumor-associated kinase homolog B (Fragment) OS=Xenopus laevis GN=hunk-b PE=2 SV=1 48 231 1.0E-06
sp|Q753D9|PKH3_ASHGO Serine/threonine-protein kinase PKH3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PKH3 PE=3 SV=1 102 219 2.0E-06
sp|B1WAS2|HUNK_XENTR Hormonally up-regulated neu tumor-associated kinase homolog OS=Xenopus tropicalis GN=hunk PE=2 SV=1 48 231 2.0E-06
sp|Q68UT7|HUNK_PANTR Hormonally up-regulated neu tumor-associated kinase OS=Pan troglodytes GN=HUNK PE=3 SV=1 31 231 2.0E-06
sp|P57058|HUNK_HUMAN Hormonally up-regulated neu tumor-associated kinase OS=Homo sapiens GN=HUNK PE=1 SV=1 31 231 2.0E-06
sp|O88866|HUNK_MOUSE Hormonally up-regulated neu tumor-associated kinase OS=Mus musculus GN=Hunk PE=2 SV=1 31 287 2.0E-06
sp|Q5XHI9|HUNKA_XENLA Hormonally up-regulated neu tumor-associated kinase homolog A OS=Xenopus laevis GN=hunk-a PE=2 SV=1 48 231 2.0E-06
sp|Q9P0L2|MARK1_HUMAN Serine/threonine-protein kinase MARK1 OS=Homo sapiens GN=MARK1 PE=1 SV=2 122 219 3.0E-06
sp|A8WYE4|PAR1_CAEBR Serine/threonine-protein kinase par-1 OS=Caenorhabditis briggsae GN=par-1 PE=3 SV=1 122 219 3.0E-06
sp|Q93VD3|CIPKN_ARATH CBL-interacting serine/threonine-protein kinase 23 OS=Arabidopsis thaliana GN=CIPK23 PE=1 SV=1 20 217 3.0E-06
sp|Q9TW45|PAR1_CAEEL Serine/threonine-protein kinase par-1 OS=Caenorhabditis elegans GN=par-1 PE=1 SV=1 122 219 4.0E-06
sp|Q9FJ54|CIPKK_ARATH CBL-interacting serine/threonine-protein kinase 20 OS=Arabidopsis thaliana GN=CIPK20 PE=1 SV=1 75 219 4.0E-06
sp|Q9SEZ7|CIPKG_ARATH CBL-interacting serine/threonine-protein kinase 16 OS=Arabidopsis thaliana GN=CIPK16 PE=1 SV=1 31 216 5.0E-06
sp|Q2QMI0|CIPK4_ORYSJ CBL-interacting protein kinase 4 OS=Oryza sativa subsp. japonica GN=CIPK4 PE=2 SV=2 73 217 7.0E-06
sp|Q8S9D1|PP395_ARATH Pentatricopeptide repeat-containing protein At5g21222 OS=Arabidopsis thaliana GN=ATC401 PE=2 SV=1 29 217 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0006468 protein phosphorylation Yes
GO:0044238 primary metabolic process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0006793 phosphorus metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0044267 cellular protein metabolic process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0036094 small molecule binding No
GO:0016301 kinase activity No
GO:0044260 cellular macromolecule metabolic process No
GO:0008144 drug binding No
GO:0036211 protein modification process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0003824 catalytic activity No
GO:0016310 phosphorylation No
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006464 cellular protein modification process No
GO:1901363 heterocyclic compound binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:0097367 carbohydrate derivative binding No
GO:0043170 macromolecule metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0019538 protein metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032553 ribonucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0140096 catalytic activity, acting on a protein No
GO:0006796 phosphate-containing compound metabolic process No
GO:0043412 macromolecule modification No
GO:0017076 purine nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10282
MQQPRWNRLIKPSSHRFFPFGATEWAFRIDDDIALKFAKRECDNPVCFQHENDTYDILEKHEPSIYIAQSFVRVH
IANLMPLMSGGSLEQRIRGNQKLNNSGHLVEVTRKEPLHLVQRWAIELTGAVACLESLGLVQGDLRPDNLLLDGN
DPLKLADFDYANSIGTRSDGNAPPWARVLGEEAGAATGSFGKNGAETEQFAIGSIIYNLTRGHRPYEGQVSGPDL
VQRLLDMNFPELAGGRLDEITHRCWMGSYNTLKELAEETAGLEGAIAQPRATVLDVEYTTKMRERCRRLLEEGLL
AEAERILQRTMEAKWDDERYQDAENLNGYTCGKQAIDAARSRVRNQDITSDARLSQWQ*
Coding >Hirsu2|10282
ATGCAACAACCACGATGGAACCGTCTCATCAAGCCTTCAAGTCATAGATTTTTTCCTTTTGGGGCGACTGAATGG
GCGTTTCGGATTGATGACGACATTGCCCTAAAGTTTGCCAAGCGTGAATGTGATAACCCGGTGTGCTTTCAGCAC
GAGAACGACACCTATGATATCCTTGAGAAGCATGAGCCATCTATTTACATCGCCCAAAGCTTCGTACGTGTTCAC
ATTGCAAATCTCATGCCTCTCATGAGTGGCGGGTCTTTGGAGCAGCGAATCAGGGGCAATCAGAAACTTAACAAC
TCGGGACATCTCGTCGAAGTGACACGGAAGGAGCCGCTCCATCTGGTTCAGCGATGGGCCATAGAACTTACAGGT
GCAGTAGCCTGTCTGGAGTCTCTGGGACTGGTTCAAGGGGACTTACGGCCCGACAACCTGCTACTCGATGGCAAC
GATCCCCTCAAACTAGCCGACTTTGACTATGCCAACAGTATTGGAACTCGATCGGACGGCAACGCGCCGCCGTGG
GCTCGCGTGCTGGGGGAGGAAGCTGGCGCTGCGACCGGATCTTTCGGGAAGAACGGAGCGGAAACCGAGCAGTTT
GCTATCGGCTCCATCATCTATAATCTGACCCGCGGCCACCGGCCGTACGAGGGCCAAGTGAGCGGACCTGACCTT
GTTCAGCGACTCCTGGACATGAACTTTCCCGAGTTGGCCGGCGGTCGCTTGGATGAGATTACTCACCGGTGCTGG
ATGGGCTCGTACAATACACTGAAAGAACTAGCCGAAGAGACGGCTGGTCTGGAGGGCGCGATCGCTCAGCCACGA
GCAACCGTGTTGGATGTTGAATATACGACGAAGATGCGTGAGCGGTGTCGCCGGTTGCTGGAAGAGGGTTTGCTT
GCAGAAGCAGAAAGGATACTGCAACGGACTATGGAAGCGAAGTGGGACGATGAGCGATATCAGGACGCCGAAAAC
CTCAACGGTTATACCTGTGGCAAACAAGCCATTGATGCTGCACGCTCGCGAGTCCGAAATCAAGACATCACGTCC
GATGCAAGACTCTCCCAATGGCAATGA
Transcript >Hirsu2|10282
ATGCAACAACCACGATGGAACCGTCTCATCAAGCCTTCAAGTCATAGATTTTTTCCTTTTGGGGCGACTGAATGG
GCGTTTCGGATTGATGACGACATTGCCCTAAAGTTTGCCAAGCGTGAATGTGATAACCCGGTGTGCTTTCAGCAC
GAGAACGACACCTATGATATCCTTGAGAAGCATGAGCCATCTATTTACATCGCCCAAAGCTTCGTACGTGTTCAC
ATTGCAAATCTCATGCCTCTCATGAGTGGCGGGTCTTTGGAGCAGCGAATCAGGGGCAATCAGAAACTTAACAAC
TCGGGACATCTCGTCGAAGTGACACGGAAGGAGCCGCTCCATCTGGTTCAGCGATGGGCCATAGAACTTACAGGT
GCAGTAGCCTGTCTGGAGTCTCTGGGACTGGTTCAAGGGGACTTACGGCCCGACAACCTGCTACTCGATGGCAAC
GATCCCCTCAAACTAGCCGACTTTGACTATGCCAACAGTATTGGAACTCGATCGGACGGCAACGCGCCGCCGTGG
GCTCGCGTGCTGGGGGAGGAAGCTGGCGCTGCGACCGGATCTTTCGGGAAGAACGGAGCGGAAACCGAGCAGTTT
GCTATCGGCTCCATCATCTATAATCTGACCCGCGGCCACCGGCCGTACGAGGGCCAAGTGAGCGGACCTGACCTT
GTTCAGCGACTCCTGGACATGAACTTTCCCGAGTTGGCCGGCGGTCGCTTGGATGAGATTACTCACCGGTGCTGG
ATGGGCTCGTACAATACACTGAAAGAACTAGCCGAAGAGACGGCTGGTCTGGAGGGCGCGATCGCTCAGCCACGA
GCAACCGTGTTGGATGTTGAATATACGACGAAGATGCGTGAGCGGTGTCGCCGGTTGCTGGAAGAGGGTTTGCTT
GCAGAAGCAGAAAGGATACTGCAACGGACTATGGAAGCGAAGTGGGACGATGAGCGATATCAGGACGCCGAAAAC
CTCAACGGTTATACCTGTGGCAAACAAGCCATTGATGCTGCACGCTCGCGAGTCCGAAATCAAGACATCACGTCC
GATGCAAGACTCTCCCAATGGCAATGA
Gene >Hirsu2|10282
ATGCAAGTACCAACAAGAGGGCCTGCATTATTCGTGCTGATTTCTCCAGTCTCTTCTGACACATAGATTAAGGCT
TAACCTTTCTGTCGTTTCATTTTCACGTGCAGACGATATTTCATACCTCGAGCATTAAACAAGCGGCAGTCATCA
TTAACGCCAACGCAGTAAGCGCATGAAACTTATTAAGGCCTTCTTGCGACCATACTTGCACTGTACTTCGTTACC
TTGTCAAGATGACGTGATGCTCGAGATATAAGAACCCACCCCCTCCTCTCCATGCCTGGCCAGGAACGCACAGAA
ATATACATGTGTTACGACTGGACAGCAACCACGATGGAACCGTCTCATCAAGCCTTCAAGTCATAGATTTTTTCC
TTTTGGGGCGACTGAATGGGCGTTTCGGATTGATGACGACATTGCCCTAAAGTTTGCCAAGCGTGAATGTGATAA
CCCGGTGTGCTTTCAGCACGAGAACGACACCTATGATATCCTTGAGAAGCATGAGCCATCTATTTACATCGCCCA
AAGCTTCGTACGTGTTCACATTGCAAATCTCATGCCTCTCATGAGTGGCGGGTCTTTGGAGCAGCGAATCAGGGG
CAATCAGAAACTTAACAACTCGGGACATCTCGTCGAAGTGACACGGAAGGAGCCGCTCCATCTGGTTCAGCGATG
GGCCATAGAACTTACAGGTGCAGTAGCCTGTCTGGAGTCTCTGGGACTGGTTCAAGGGGACTTACGGCCCGACAA
CCTGCTACTCGATGGCAACGATCCCCTCAAACTAGCCGACTTTGACTATGCCAACAGTATTGGAACTCGATCGGA
CGGCAACGCGCCGCCGTGGGCTCGCGTGCTGGGGGAGGAAGCTGGCGCTGCGACCGGATCTTTCGGGAAGAACGG
AGCGGAAACCGAGCAGTTTGCTATCGGCTCCATCATCTATAATCTGACCCGCGGCCACCGGCCGTACGAGGGCCA
AGTGAGCGGACCTGACCTTGTTCAGCGACTCCTGGACATGAACTTTCCCGAGTTGGCCGGCGGTCGCTTGGATGA
GATTACTCACCGGTGCTGGATGGGCTCGTACAATACACTGAAAGAACTAGCCGAAGAGACGGCTGGTCTGGAGGG
CGCGATCGCTCAGCCACGAGCAACCGTGTTGGATGTTGAATATACGACGAAGATGCGTGAGCGGTGTCGCCGGTT
GCTGGAAGAGGGTTTGCTTGCAGAAGCAGAAAGGATACTGCAACGGACTATGGAAGTTAGTGAGCGGTACAAGAG
AAGCTTGAACAAGTGTTGATAGGCTGGAACAAATGTGTAAGCGTTGCATGCAGGTACAGCATCCTGTGGCTGACT
GGCCAGGCGTAAGACTAACTTGGGGTACCACACGGGCATACTGTATGCACAATCGAGCGTAAGTCTGCTGAGAGT
TCGGGAGCGGATCCAACGCTTTGCCTCGTAATTCTCGACTACGATAACATAGACGTTGTAAACTCACTTTCTGTG
AGAAATATCAACTCAACTTCGTACCAGGCGAAGTGGGACGATGAGCGATATCAGGACGCCGAAAACCTCAACGGT
TATACCTGTGGCAAACAAGCCATTGATGCTGCACGCTCGCGAGTCCGAAATCAAGACATCACGTCCGATGCAAGA
CTCTCCCAATGGCAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail