Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10279
Gene name
LocationContig_814:11600..12054
Strand+
Gene length (bp)454
Transcript length (bp)411
Coding sequence length (bp)411
Protein length (aa) 137

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00690 Cation_ATPase_N Cation transporter/ATPase, N-terminus 2.7E-07 100 134

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P07038|PMA1_NEUCR Plasma membrane ATPase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pma-1 PE=1 SV=1 1 136 2.0E-33
sp|Q07421|PMA1_AJECA Plasma membrane ATPase OS=Ajellomyces capsulatus GN=PMA1 PE=3 SV=1 65 136 2.0E-24
sp|P28877|PMA1_CANAX Plasma membrane ATPase 1 OS=Candida albicans GN=PMA1 PE=1 SV=1 48 136 3.0E-20
sp|P24545|PMA1_ZYGRO Plasma membrane ATPase OS=Zygosaccharomyces rouxii PE=3 SV=1 61 136 1.0E-16
sp|P49380|PMA1_KLULA Plasma membrane ATPase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PMA1 PE=1 SV=1 68 136 1.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P07038|PMA1_NEUCR Plasma membrane ATPase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pma-1 PE=1 SV=1 1 136 2.0E-33
sp|Q07421|PMA1_AJECA Plasma membrane ATPase OS=Ajellomyces capsulatus GN=PMA1 PE=3 SV=1 65 136 2.0E-24
sp|P28877|PMA1_CANAX Plasma membrane ATPase 1 OS=Candida albicans GN=PMA1 PE=1 SV=1 48 136 3.0E-20
sp|P24545|PMA1_ZYGRO Plasma membrane ATPase OS=Zygosaccharomyces rouxii PE=3 SV=1 61 136 1.0E-16
sp|P49380|PMA1_KLULA Plasma membrane ATPase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PMA1 PE=1 SV=1 68 136 1.0E-15
sp|P09627|PMA1_SCHPO Plasma membrane ATPase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pma1 PE=1 SV=1 67 136 8.0E-15
sp|P05030|PMA1_YEAST Plasma membrane ATPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMA1 PE=1 SV=2 68 136 9.0E-13
sp|P28876|PMA2_SCHPO Plasma membrane ATPase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pma2 PE=3 SV=1 67 136 1.0E-12
sp|P19657|PMA2_YEAST Plasma membrane ATPase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMA2 PE=1 SV=3 87 136 4.0E-10
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 48 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10279
MADDKSAGAPALDTNIESGRFDEKRAQQQQGQQHDEHEQHAEAGQAPPHHHKAPAADDDDEDEDIDALIEDLESQ
DGHGGFEEEEEEGSPGGGRVVPEDMLQTDSRVGLTESEVHTRRRKYGLNQMKEEKENMILK*
Coding >Hirsu2|10279
ATGGCCGACGACAAGTCTGCCGGCGCGCCCGCGCTCGACACCAACATCGAGTCGGGCCGCTTCGACGAGAAGAGG
GCGCAGCAGCAGCAGGGCCAGCAGCATGATGAGCACGAGCAGCACGCCGAGGCGGGGCAGGCCCCTCCGCACCAC
CACAAGGCCCCCGCCGCCGACGACGACGACGAGGACGAGGACATCGACGCCCTGATTGAGGACCTCGAGTCCCAG
GACGGCCACGGCGGCTTCGAGGAGGAGGAGGAGGAGGGCAGCCCGGGCGGCGGCCGCGTCGTGCCCGAGGACATG
CTGCAGACGGACAGCCGCGTCGGCCTGACCGAGTCCGAGGTGCACACGCGCCGCCGCAAGTACGGCCTCAACCAG
ATGAAGGAGGAGAAGGAGAACATGATTCTCAAGTGA
Transcript >Hirsu2|10279
ATGGCCGACGACAAGTCTGCCGGCGCGCCCGCGCTCGACACCAACATCGAGTCGGGCCGCTTCGACGAGAAGAGG
GCGCAGCAGCAGCAGGGCCAGCAGCATGATGAGCACGAGCAGCACGCCGAGGCGGGGCAGGCCCCTCCGCACCAC
CACAAGGCCCCCGCCGCCGACGACGACGACGAGGACGAGGACATCGACGCCCTGATTGAGGACCTCGAGTCCCAG
GACGGCCACGGCGGCTTCGAGGAGGAGGAGGAGGAGGGCAGCCCGGGCGGCGGCCGCGTCGTGCCCGAGGACATG
CTGCAGACGGACAGCCGCGTCGGCCTGACCGAGTCCGAGGTGCACACGCGCCGCCGCAAGTACGGCCTCAACCAG
ATGAAGGAGGAGAAGGAGAACATGATTCTCAAGTGA
Gene >Hirsu2|10279
ATGGCCGACGACAAGTCTGCCGGCGCGCCCGCGCTCGACACCAACATCGAGTCGGGCCGCTTCGACGAGAAGAGG
GCGCAGCAGCAGCAGGGCCAGCAGCATGATGAGCACGAGCAGCACGCCGAGGCGGGGCAGGCCCCTCCGCACCAC
CACAAGGCCCCCGCCGCCGACGACGACGACGAGGACGAGGACATCGACGCCCTGATTGAGGACCTCGAGTCCCAG
GACGGCCACGGCGGCTTCGAGGAGGAGGAGGAGGAGGGCAGCCCGGGCGGCGGCCGCGTCGTGCCCGAGGACATG
CTGCAGACGGACAGCCGCGTCGGCCTGACCGAGTCCGAGGTGCACACGCGCCGCCGCAAGTACGGCCTCAACCAG
ATGAAGGAGGAGAAGGAGAACATGATTCTCAAGTTCTTCTCCTACTTTGTCGGCCCCATCCAGTTTGTCATGGAG
GTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail