Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10252
Gene name
LocationContig_81:26747..28645
Strand-
Gene length (bp)1898
Transcript length (bp)1626
Coding sequence length (bp)1626
Protein length (aa) 542

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01490 Aa_trans Transmembrane amino acid transporter protein 7.3E-67 139 526

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P39981|AVT2_YEAST Vacuolar amino acid transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT2 PE=2 SV=1 137 536 6.0E-100
sp|D3Z813|S38AB_RAT Putative sodium-coupled neutral amino acid transporter 11 OS=Rattus norvegicus GN=Slc38a11 PE=2 SV=1 138 526 1.0E-70
sp|Q3USY0|S38AB_MOUSE Putative sodium-coupled neutral amino acid transporter 11 OS=Mus musculus GN=Slc38a11 PE=2 SV=2 138 526 1.0E-70
sp|Q5EA97|S38AB_BOVIN Putative sodium-coupled neutral amino acid transporter 11 OS=Bos taurus GN=SLC38A11 PE=2 SV=1 124 527 1.0E-67
sp|A8KBL5|S38AB_DANRE Putative sodium-coupled neutral amino acid transporter 11 OS=Danio rerio GN=slc38a11 PE=2 SV=2 161 527 4.0E-66
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P39981|AVT2_YEAST Vacuolar amino acid transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT2 PE=2 SV=1 137 536 6.0E-100
sp|D3Z813|S38AB_RAT Putative sodium-coupled neutral amino acid transporter 11 OS=Rattus norvegicus GN=Slc38a11 PE=2 SV=1 138 526 1.0E-70
sp|Q3USY0|S38AB_MOUSE Putative sodium-coupled neutral amino acid transporter 11 OS=Mus musculus GN=Slc38a11 PE=2 SV=2 138 526 1.0E-70
sp|Q5EA97|S38AB_BOVIN Putative sodium-coupled neutral amino acid transporter 11 OS=Bos taurus GN=SLC38A11 PE=2 SV=1 124 527 1.0E-67
sp|A8KBL5|S38AB_DANRE Putative sodium-coupled neutral amino acid transporter 11 OS=Danio rerio GN=slc38a11 PE=2 SV=2 161 527 4.0E-66
sp|Q8HXI3|S38AB_MACFA Putative sodium-coupled neutral amino acid transporter 11 OS=Macaca fascicularis GN=SLC38A11 PE=2 SV=1 91 526 8.0E-57
sp|Q08AI6|S38AB_HUMAN Putative sodium-coupled neutral amino acid transporter 11 OS=Homo sapiens GN=SLC38A11 PE=2 SV=1 164 526 1.0E-54
sp|Q6DEL1|S38A7_DANRE Putative sodium-coupled neutral amino acid transporter 7 OS=Danio rerio GN=slc38a7 PE=2 SV=1 133 520 5.0E-31
sp|Q9JM15|S38A1_RAT Sodium-coupled neutral amino acid transporter 1 OS=Rattus norvegicus GN=Slc38a1 PE=1 SV=1 131 500 1.0E-27
sp|Q6JWR2|S38A7_RAT Putative sodium-coupled neutral amino acid transporter 7 OS=Rattus norvegicus GN=Slc38a7 PE=2 SV=1 129 513 1.0E-27
sp|Q8K2P7|S38A1_MOUSE Sodium-coupled neutral amino acid transporter 1 OS=Mus musculus GN=Slc38a1 PE=1 SV=1 131 500 1.0E-27
sp|Q8BWH0|S38A7_MOUSE Putative sodium-coupled neutral amino acid transporter 7 OS=Mus musculus GN=Slc38a7 PE=1 SV=1 128 513 2.0E-27
sp|Q28HE5|S38A6_XENTR Probable sodium-coupled neutral amino acid transporter 6 OS=Xenopus tropicalis GN=slc38a6 PE=2 SV=1 124 518 6.0E-27
sp|Q6WWW3|S38A6_RAT Probable sodium-coupled neutral amino acid transporter 6 OS=Rattus norvegicus GN=Slc38a6 PE=2 SV=1 110 518 8.0E-27
sp|Q5I012|S38AA_MOUSE Putative sodium-coupled neutral amino acid transporter 10 OS=Mus musculus GN=Slc38a10 PE=1 SV=2 147 524 8.0E-27
sp|G3UVW3|S38A6_MOUSE Probable sodium-coupled neutral amino acid transporter 6 OS=Mus musculus GN=Slc38a6 PE=2 SV=1 112 518 9.0E-27
sp|Q8IZM9|S38A6_HUMAN Probable sodium-coupled neutral amino acid transporter 6 OS=Homo sapiens GN=SLC38A6 PE=1 SV=2 127 518 1.0E-26
sp|Q9JHZ9|S38A3_RAT Sodium-coupled neutral amino acid transporter 3 OS=Rattus norvegicus GN=Slc38a3 PE=2 SV=1 124 502 2.0E-26
sp|Q9H2H9|S38A1_HUMAN Sodium-coupled neutral amino acid transporter 1 OS=Homo sapiens GN=SLC38A1 PE=1 SV=1 131 499 2.0E-26
sp|Q5R9F5|S38A7_PONAB Putative sodium-coupled neutral amino acid transporter 7 OS=Pongo abelii GN=SLC38A7 PE=2 SV=1 128 513 4.0E-26
sp|Q5R443|S38A1_PONAB Sodium-coupled neutral amino acid transporter 1 OS=Pongo abelii GN=SLC38A1 PE=2 SV=1 131 499 9.0E-26
sp|Q99624|S38A3_HUMAN Sodium-coupled neutral amino acid transporter 3 OS=Homo sapiens GN=SLC38A3 PE=1 SV=1 90 501 1.0E-25
sp|Q9DCP2|S38A3_MOUSE Sodium-coupled neutral amino acid transporter 3 OS=Mus musculus GN=Slc38a3 PE=1 SV=1 127 501 2.0E-25
sp|Q9NVC3|S38A7_HUMAN Putative sodium-coupled neutral amino acid transporter 7 OS=Homo sapiens GN=SLC38A7 PE=1 SV=1 134 513 2.0E-25
sp|A7E3U5|S38A7_BOVIN Putative sodium-coupled neutral amino acid transporter 7 OS=Bos taurus GN=SLC38A7 PE=2 SV=1 144 513 4.0E-25
sp|E9PT23|S38AA_RAT Putative sodium-coupled neutral amino acid transporter 10 OS=Rattus norvegicus GN=Slc38a10 PE=2 SV=2 147 524 9.0E-25
sp|Q503G8|S38A6_DANRE Probable sodium-coupled neutral amino acid transporter 6 OS=Danio rerio GN=slc38a6 PE=2 SV=1 136 537 2.0E-24
sp|Q5E9S9|S38A5_BOVIN Sodium-coupled neutral amino acid transporter 5 OS=Bos taurus GN=SLC38A5 PE=2 SV=1 138 523 7.0E-24
sp|Q8WUX1|S38A5_HUMAN Sodium-coupled neutral amino acid transporter 5 OS=Homo sapiens GN=SLC38A5 PE=1 SV=1 138 523 3.0E-23
sp|Q9HBR0|S38AA_HUMAN Putative sodium-coupled neutral amino acid transporter 10 OS=Homo sapiens GN=SLC38A10 PE=1 SV=2 147 524 3.0E-23
sp|Q5RC98|S38AA_PONAB Putative sodium-coupled neutral amino acid transporter 10 OS=Pongo abelii GN=SLC38A10 PE=2 SV=1 147 524 3.0E-23
sp|Q6DFE7|S38A7_XENLA Putative sodium-coupled neutral amino acid transporter 7 OS=Xenopus laevis GN=slc38a7 PE=2 SV=1 133 520 1.0E-21
sp|Q3U1J0|S38A5_MOUSE Sodium-coupled neutral amino acid transporter 5 OS=Mus musculus GN=Slc38a5 PE=1 SV=1 138 523 2.0E-21
sp|Q5SPB1|S38A2_DANRE Sodium-coupled neutral amino acid transporter 2 OS=Danio rerio GN=slc38a2 PE=3 SV=1 89 500 3.0E-21
sp|A2VCW5|S38A5_RAT Sodium-coupled neutral amino acid transporter 5 OS=Rattus norvegicus GN=Slc38a5 PE=1 SV=1 138 523 8.0E-21
sp|Q5XH90|S38A2_XENTR Sodium-coupled neutral amino acid transporter 2 OS=Xenopus tropicalis GN=slc38a2 PE=2 SV=1 71 520 7.0E-20
sp|Q9JHE5|S38A2_RAT Sodium-coupled neutral amino acid transporter 2 OS=Rattus norvegicus GN=Slc38a2 PE=1 SV=1 146 520 1.0E-19
sp|Q6PCF9|S38AA_XENLA Putative sodium-coupled neutral amino acid transporter 10 OS=Xenopus laevis GN=slc38a10 PE=2 SV=1 145 522 1.0E-17
sp|O74327|AVT5_SCHPO Vacuolar amino acid transporter 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=avt5 PE=3 SV=1 132 495 2.0E-17
sp|Q5F468|S38A2_CHICK Sodium-coupled neutral amino acid transporter 2 OS=Gallus gallus GN=SLC38A2 PE=2 SV=2 147 500 6.0E-17
sp|A6NNN8|S38A8_HUMAN Putative sodium-coupled neutral amino acid transporter 8 OS=Homo sapiens GN=SLC38A8 PE=1 SV=1 139 496 1.0E-16
sp|P40074|AVT6_YEAST Vacuolar amino acid transporter 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT6 PE=1 SV=1 139 432 1.0E-15
sp|A1YG32|S38A2_PANPA Sodium-coupled neutral amino acid transporter 2 OS=Pan paniscus GN=SLC38A2 PE=3 SV=1 146 500 2.0E-15
sp|Q96QD8|S38A2_HUMAN Sodium-coupled neutral amino acid transporter 2 OS=Homo sapiens GN=SLC38A2 PE=1 SV=2 146 500 2.0E-15
sp|Q5HZH7|S38A8_MOUSE Putative sodium-coupled neutral amino acid transporter 8 OS=Mus musculus GN=Slc38a8 PE=2 SV=1 128 496 3.0E-15
sp|Q8CFE6|S38A2_MOUSE Sodium-coupled neutral amino acid transporter 2 OS=Mus musculus GN=Slc38a2 PE=1 SV=1 146 500 1.0E-14
sp|Q19425|S38A9_CAEEL Sodium-coupled neutral amino acid transporter 9 homolog OS=Caenorhabditis elegans GN=F13H10.3 PE=3 SV=2 138 520 2.0E-14
sp|A2VE31|S38A2_BOVIN Sodium-coupled neutral amino acid transporter 2 OS=Bos taurus GN=SLC38A2 PE=2 SV=1 146 500 2.0E-14
sp|P38176|AVT5_YEAST Vacuolar amino acid transporter 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT5 PE=3 SV=2 139 523 4.0E-14
sp|Q5RE87|S38A4_PONAB Sodium-coupled neutral amino acid transporter 4 OS=Pongo abelii GN=SLC38A4 PE=2 SV=1 335 520 5.0E-13
sp|Q969I6|S38A4_HUMAN Sodium-coupled neutral amino acid transporter 4 OS=Homo sapiens GN=SLC38A4 PE=1 SV=1 335 516 5.0E-13
sp|P40501|AVT7_YEAST Vacuolar amino acid transporter 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT7 PE=1 SV=1 134 426 6.0E-12
sp|Q8R1S9|S38A4_MOUSE Sodium-coupled neutral amino acid transporter 4 OS=Mus musculus GN=Slc38a4 PE=1 SV=1 313 500 9.0E-12
sp|Q9EQ25|S38A4_RAT Sodium-coupled neutral amino acid transporter 4 OS=Rattus norvegicus GN=Slc38a4 PE=1 SV=1 335 500 5.0E-11
sp|Q28I47|S38A8_XENTR Putative sodium-coupled neutral amino acid transporter 8 OS=Xenopus tropicalis GN=slc38a8 PE=2 SV=1 138 496 9.0E-11
sp|O22719|LHTL3_ARATH Lysine histidine transporter-like 3 OS=Arabidopsis thaliana GN=At1g61270 PE=3 SV=2 125 537 5.0E-09
sp|Q4KL91|S36A4_XENLA Proton-coupled amino acid transporter 4 OS=Xenopus laevis GN=slc36a4 PE=2 SV=1 124 496 1.0E-08
sp|F4ILY9|ANTL1_ARATH Amino acid transporter ANTL1 OS=Arabidopsis thaliana GN=At2g42005 PE=2 SV=1 136 504 3.0E-08
sp|Q5RE87|S38A4_PONAB Sodium-coupled neutral amino acid transporter 4 OS=Pongo abelii GN=SLC38A4 PE=2 SV=1 146 309 1.0E-07
sp|Q969I6|S38A4_HUMAN Sodium-coupled neutral amino acid transporter 4 OS=Homo sapiens GN=SLC38A4 PE=1 SV=1 125 309 1.0E-07
sp|Q8R1S9|S38A4_MOUSE Sodium-coupled neutral amino acid transporter 4 OS=Mus musculus GN=Slc38a4 PE=1 SV=1 125 309 1.0E-07
sp|Q9SS86|LHTL4_ARATH Lysine histidine transporter-like 4 OS=Arabidopsis thaliana GN=At3g01760 PE=3 SV=2 128 535 3.0E-07
sp|Q9EQ25|S38A4_RAT Sodium-coupled neutral amino acid transporter 4 OS=Rattus norvegicus GN=Slc38a4 PE=1 SV=1 125 309 8.0E-07
sp|P36062|AVT3_YEAST Vacuolar amino acid transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT3 PE=1 SV=1 266 528 9.0E-07
sp|P50944|AVT4_YEAST Vacuolar amino acid transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT4 PE=1 SV=1 72 526 2.0E-06
sp|Q9SF09|ANT1_ARATH Amino acid transporter ANT1 OS=Arabidopsis thaliana GN=ANT1 PE=1 SV=1 147 516 3.0E-06
sp|Q8NBW4|S38A9_HUMAN Sodium-coupled neutral amino acid transporter 9 OS=Homo sapiens GN=SLC38A9 PE=1 SV=2 397 522 3.0E-06
sp|Q6DIV6|VIAAT_XENTR Vesicular inhibitory amino acid transporter OS=Xenopus tropicalis GN=slc32a1 PE=2 SV=1 136 536 4.0E-06
sp|Q8BGD6|S38A9_MOUSE Sodium-coupled neutral amino acid transporter 9 OS=Mus musculus GN=Slc38a9 PE=1 SV=1 312 513 5.0E-06
sp|Q9FKS8|LHT1_ARATH Lysine histidine transporter 1 OS=Arabidopsis thaliana GN=LHT1 PE=1 SV=1 124 536 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 140 162 22
2 172 194 22
3 215 237 22
4 265 282 17
5 295 317 22
6 332 354 22
7 367 389 22
8 409 431 22
9 451 473 22
10 477 499 22
11 506 528 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10252
MIQARERGNEPQRPEEGRGLLAGDVDDEYDLAMLPLPGKDDAAEGETDRPRAQRTTSRVQFDLTPEVIGPSNGSA
GSARLSSESSLSFDLDDEAAEGGPRPSHRVPLLTDMEAPSVAVANAWGDEAADELHAEMRRPKSGLQSAFMNMAN
SIIGAGIIGQPYAMRQAGLLAGIVLLVGLTAVVDWTICLIVINSKLSGTSSFQGTVEHCFGRAGLIAISAAQWIF
AFGGMVAFGVIVGDTIPHVLAAVWPELSSVPVLGLLTDRRVAIAVFIMGVSYPLTLYRDIAKLAKASTFALIGMM
VIVSTVLVQGLLVAPEARGSFSTQLLTVNGGIFQAIGVISFAFVCHHNSLLIYGSLRTPTIDNFSRVTHYSTGMS
MLACLVMALGGFLTFGDKTLGNVLNNFPSDNGMVNVARLFFGLNMLTTLPLEAFVCREVMLTYWYPDEGFSMRRH
LVLSSGLVAGATALSLLTCDLGVVFELVGATSAVAMAYILPPMCYIRLTRTSWRTYMAYAVVVFGVAVMVISVIQ
AARRMISGAEGPAQCA*
Coding >Hirsu2|10252
ATGATTCAGGCCAGGGAACGTGGCAACGAGCCGCAGCGGCCCGAGGAGGGCCGTGGCCTGCTGGCGGGCGACGTT
GACGACGAGTACGACCTGGCGATGCTCCCGCTGCCCGGCAAGGACGACGCCGCCGAGGGCGAGACGGACCGGCCG
AGAGCGCAGCGGACGACGAGCCGGGTGCAGTTCGACCTCACACCCGAGGTGATAGGGCCCAGCAATGGCTCGGCC
GGCTCGGCGCGGCTCTCGTCCGAGTCGAGCCTGAGCTTCGACCTGGACGACGAGGCTGCCGAGGGTGGGCCGCGG
CCATCGCACCGCGTGCCGCTGCTGACGGACATGGAGGCGCCCAGCGTGGCGGTGGCGAACGCGTGGGGCGACGAG
GCGGCCGACGAGCTCCACGCCGAGATGCGGCGGCCCAAGTCGGGCCTGCAGTCGGCCTTCATGAACATGGCCAAC
TCCATCATCGGCGCCGGCATCATCGGGCAGCCGTACGCGATGCGCCAGGCCGGGCTGCTGGCCGGCATCGTGCTG
CTGGTGGGGCTGACGGCGGTGGTGGACTGGACCATCTGCCTCATCGTCATCAACAGCAAGCTCAGCGGGACCAGC
AGCTTCCAGGGCACGGTGGAGCACTGCTTTGGGCGGGCCGGCCTCATCGCCATCAGCGCCGCGCAGTGGATCTTC
GCGTTCGGCGGCATGGTGGCGTTCGGCGTCATCGTCGGCGACACCATCCCGCACGTGCTGGCGGCCGTCTGGCCC
GAGCTCAGCTCCGTGCCGGTGCTGGGGCTGCTGACGGACAGGCGGGTGGCCATCGCCGTCTTCATCATGGGCGTG
AGCTACCCGCTGACGCTGTACCGGGACATTGCCAAGCTGGCCAAGGCGAGCACGTTTGCGCTCATCGGGATGATG
GTCATCGTCAGCACGGTGCTCGTGCAGGGCCTGCTGGTGGCGCCCGAGGCCCGAGGCTCGTTCAGCACGCAGCTG
CTGACGGTCAACGGGGGCATCTTCCAAGCCATTGGCGTCATATCCTTCGCGTTCGTGTGCCACCACAACTCGCTC
CTCATCTACGGGTCGCTGCGGACGCCGACCATCGACAACTTCTCGCGGGTGACGCACTACTCGACGGGGATGTCG
ATGCTGGCGTGCCTGGTGATGGCGCTGGGGGGGTTCCTGACGTTCGGCGACAAGACGCTGGGCAACGTGCTCAAC
AACTTCCCGTCGGACAACGGCATGGTCAACGTGGCGCGGCTGTTCTTTGGGCTCAACATGCTGACGACGCTGCCG
CTGGAGGCGTTCGTGTGCCGCGAGGTGATGCTGACGTACTGGTACCCGGACGAGGGCTTCAGCATGCGGCGGCAC
CTGGTGCTGAGCAGCGGGCTGGTGGCCGGGGCGACGGCGCTGAGCCTCCTGACGTGCGACCTGGGCGTCGTCTTC
GAGCTGGTCGGGGCGACGAGCGCGGTGGCCATGGCGTACATCCTGCCGCCCATGTGCTACATCCGACTGACGAGG
ACGAGCTGGCGGACGTACATGGCGTACGCGGTGGTGGTGTTTGGCGTGGCCGTCATGGTCATCAGCGTGATACAG
GCGGCGCGCAGGATGATCAGCGGCGCAGAGGGGCCGGCGCAGTGTGCGTGA
Transcript >Hirsu2|10252
ATGATTCAGGCCAGGGAACGTGGCAACGAGCCGCAGCGGCCCGAGGAGGGCCGTGGCCTGCTGGCGGGCGACGTT
GACGACGAGTACGACCTGGCGATGCTCCCGCTGCCCGGCAAGGACGACGCCGCCGAGGGCGAGACGGACCGGCCG
AGAGCGCAGCGGACGACGAGCCGGGTGCAGTTCGACCTCACACCCGAGGTGATAGGGCCCAGCAATGGCTCGGCC
GGCTCGGCGCGGCTCTCGTCCGAGTCGAGCCTGAGCTTCGACCTGGACGACGAGGCTGCCGAGGGTGGGCCGCGG
CCATCGCACCGCGTGCCGCTGCTGACGGACATGGAGGCGCCCAGCGTGGCGGTGGCGAACGCGTGGGGCGACGAG
GCGGCCGACGAGCTCCACGCCGAGATGCGGCGGCCCAAGTCGGGCCTGCAGTCGGCCTTCATGAACATGGCCAAC
TCCATCATCGGCGCCGGCATCATCGGGCAGCCGTACGCGATGCGCCAGGCCGGGCTGCTGGCCGGCATCGTGCTG
CTGGTGGGGCTGACGGCGGTGGTGGACTGGACCATCTGCCTCATCGTCATCAACAGCAAGCTCAGCGGGACCAGC
AGCTTCCAGGGCACGGTGGAGCACTGCTTTGGGCGGGCCGGCCTCATCGCCATCAGCGCCGCGCAGTGGATCTTC
GCGTTCGGCGGCATGGTGGCGTTCGGCGTCATCGTCGGCGACACCATCCCGCACGTGCTGGCGGCCGTCTGGCCC
GAGCTCAGCTCCGTGCCGGTGCTGGGGCTGCTGACGGACAGGCGGGTGGCCATCGCCGTCTTCATCATGGGCGTG
AGCTACCCGCTGACGCTGTACCGGGACATTGCCAAGCTGGCCAAGGCGAGCACGTTTGCGCTCATCGGGATGATG
GTCATCGTCAGCACGGTGCTCGTGCAGGGCCTGCTGGTGGCGCCCGAGGCCCGAGGCTCGTTCAGCACGCAGCTG
CTGACGGTCAACGGGGGCATCTTCCAAGCCATTGGCGTCATATCCTTCGCGTTCGTGTGCCACCACAACTCGCTC
CTCATCTACGGGTCGCTGCGGACGCCGACCATCGACAACTTCTCGCGGGTGACGCACTACTCGACGGGGATGTCG
ATGCTGGCGTGCCTGGTGATGGCGCTGGGGGGGTTCCTGACGTTCGGCGACAAGACGCTGGGCAACGTGCTCAAC
AACTTCCCGTCGGACAACGGCATGGTCAACGTGGCGCGGCTGTTCTTTGGGCTCAACATGCTGACGACGCTGCCG
CTGGAGGCGTTCGTGTGCCGCGAGGTGATGCTGACGTACTGGTACCCGGACGAGGGCTTCAGCATGCGGCGGCAC
CTGGTGCTGAGCAGCGGGCTGGTGGCCGGGGCGACGGCGCTGAGCCTCCTGACGTGCGACCTGGGCGTCGTCTTC
GAGCTGGTCGGGGCGACGAGCGCGGTGGCCATGGCGTACATCCTGCCGCCCATGTGCTACATCCGACTGACGAGG
ACGAGCTGGCGGACGTACATGGCGTACGCGGTGGTGGTGTTTGGCGTGGCCGTCATGGTCATCAGCGTGATACAG
GCGGCGCGCAGGATGATCAGCGGCGCAGAGGGGCCGGCGCAGTGTGCGTGA
Gene >Hirsu2|10252
ATGATTCAGGCCAGGGAACGTGGCAACGAGCCGCAGCGGCCCGAGGAGGGCCGTGGCCTGCTGGCGGGCGACGTT
GACGACGAGTACGACCTGGCGATGCTCCCGCTGCCCGGCAAGGACGACGCCGCCGAGGGCGAGACGGACCGGCCG
AGAGCGCAGCGGACGACGAGCCGGGTGCAGTTCGACCTCACACCCGAGGTGATAGGGCCCAGCAATGGCTCGGCC
GGCTCGGCGCGGCTCTCGTCCGAGTCGAGCCTGAGCTTCGACCTGGACGACGAGGCTGCCGAGGGTGGGCCGCGG
CCATCGCACCGCGTGCCGCTGCTGACGGACATGGAGGCGCCCAGCGTGGCGGTGGCGAACGCGTGGGGCGACGAG
GCGGCCGACGAGCTCCACGCCGAGATGCGGCGGCCCAAGTCGGGCCTGCAGTCGGCCTTCATGAACATGGCCAAC
TCCATCATCGGCGCCGGCATCATCGGGCAGCCGTACGCGATGCGCCAGGCCGGGCTGCTGGCCGGCATCGTGCTG
CTGGTGGGGCTGACGGCGGTGGTGGACTGGACCATCTGCCTCATCGTCATCAACAGCAAGCTCAGCGGGACCAGC
AGCTTCCAGGGCACGGTGGAGCACTGCTTTGGGCGGGCCGGCCTCATCGCCATCAGCGCCGCGCAGTGGATCTTC
GCGTTCGGCGGCATGGTGGCGTTCGGCGTCATCGTCGGCGACACCATCCCGCACGTGCTGGCGGCCGTCTGGCCC
GAGCTCAGCTCCGTGCCGGTGCTGGGGCTGCTGACGGACAGGCGGGTGGCCATCGCCGTCTTCATCATGGGCGTG
AGCTACCCGCTGACGCTGTACCGGGACATTGCCAAGGTGAGGCCACCCCCGAGCGAGGCAGGGCCGCGGACGGTT
TGCGGTCGAAGGCTAACGAGGGCCTGCCGTTTTTGTGTGTGCGTGGCCCGTGCTGCAGCTGGCCAAGGCGAGCAC
GTTTGCGCTCATCGGGATGATGGTCATCGTCAGCACGGTGCTCGTGCAGGGCCTGCTGGTGGCGCCCGAGGCCCG
AGGCTCGTTCAGCACGCAGCTGCTGACGGTCAACGGGGGCATCTTCCAAGCCATTGGCGTCATATCCTTCGGTAC
GGGCACACTGGGTCACGAGGGGGAGACCGAGGCGGTTCGGGCGAACGGGACGAGCGAGAGTGACTGACGTGACGT
CGGGCGGGCAGCGTTCGTGTGCCACCACAACTCGCTCCTCATCTACGGGTCGCTGCGGACGCCGACCATCGACAA
CTTCTCGCGGGTGACGCACTACTCGACGGGGATGTCGATGCTGGCGTGCCTGGTGATGGCGCTGGGGGGGTTCCT
GACGTTCGGCGACAAGACGCTGGGCAACGTGCTCAACAACTTCCCGTCGGACAACGGCATGGTCAACGTGGCGCG
GCTGTTCTTTGGGCTCAACATGCTGACGACGCTGCCGCTGGAGGCGTTCGTGTGCCGCGAGGTGATGCTGACGTA
CTGGTACCCGGACGAGGGCTTCAGCATGCGGCGGCACCTGGTGCTGAGCAGCGGGCTGGTGGCCGGGGCGACGGC
GCTGAGCCTCCTGACGTGCGACCTGGGCGTCGTCTTCGAGCTGGTCGGGGCGACGAGCGCGGTGGCCATGGCGTA
CATCCTGCCGCCCATGTGCTACATCCGACTGACGAGGACGAGCTGGCGGACGTACATGGCGTACGCGGTGGTGGT
GTTTGGCGTGGCCGTCATGGTCATCAGCGTGATACAGGCGGCGCGCAGGATGATCAGCGGTAAGGTCCTCCTCGG
TGACGGCGGTGCCGCCGGTGCGCCTGGGTCTGGGCTAACGTCTGTCTTTTCTCTCTCTCGTCTCTACAGGCGCAG
AGGGGCCGGCGCAGTGTGCGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail