Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10245
Gene name
LocationContig_81:8765..9301
Strand-
Gene length (bp)536
Transcript length (bp)447
Coding sequence length (bp)447
Protein length (aa) 149

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.548 0.5876 0.1254 0.0942 0.0614 0.0036 0.0709 0.2101 0.1849 0.0597

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4789
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|679
Ophiocordyceps australis map64 (Brazil) OphauB2|4300
Ophiocordyceps subramaniannii Hirsu2|10245 (this protein)
Ophiocordyceps subramaniannii Hirsu2|10633
Ophiocordyceps subramaniannii Hirsu2|119
Ophiocordyceps subramaniannii Hirsu2|8006

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10245
MAVYCASKALGFEAVKRLGVEQEPSFDIVHIMPSWVLGQLEGTTVHLDDMAKMHVLALDSKVQDDQEFMAASPES
TDWAGASDIARKRYLKECARGIFGFDSIPRPLTRKLRIDSRKAEKTFGFTFKPFEEQVVSVVDHFLELVAGKE*
Coding >Hirsu2|10245
ATGGCGGTCTATTGCGCCTCCAAGGCGCTAGGCTTCGAGGCCGTCAAGCGTTTGGGGGTCGAGCAGGAGCCGTCC
TTCGACATCGTTCACATCATGCCTTCATGGGTGCTCGGCCAGCTCGAAGGCACCACGGTGCACCTCGACGACATG
GCCAAGATGCACGTCCTGGCCCTCGACAGCAAAGTCCAGGACGACCAGGAGTTCATGGCGGCCTCCCCTGAGAGC
ACTGACTGGGCGGGGGCGTCTGATATAGCCAGAAAGCGTTATCTGAAGGAATGCGCGCGAGGCATTTTTGGCTTC
GACTCGATCCCAAGGCCGTTGACGCGCAAGCTCAGGATTGATAGCAGAAAGGCAGAGAAGACGTTTGGGTTTACC
TTTAAGCCGTTTGAGGAGCAGGTTGTGTCGGTGGTGGACCACTTCCTCGAGCTGGTGGCGGGTAAAGAATGA
Transcript >Hirsu2|10245
ATGGCGGTCTATTGCGCCTCCAAGGCGCTAGGCTTCGAGGCCGTCAAGCGTTTGGGGGTCGAGCAGGAGCCGTCC
TTCGACATCGTTCACATCATGCCTTCATGGGTGCTCGGCCAGCTCGAAGGCACCACGGTGCACCTCGACGACATG
GCCAAGATGCACGTCCTGGCCCTCGACAGCAAAGTCCAGGACGACCAGGAGTTCATGGCGGCCTCCCCTGAGAGC
ACTGACTGGGCGGGGGCGTCTGATATAGCCAGAAAGCGTTATCTGAAGGAATGCGCGCGAGGCATTTTTGGCTTC
GACTCGATCCCAAGGCCGTTGACGCGCAAGCTCAGGATTGATAGCAGAAAGGCAGAGAAGACGTTTGGGTTTACC
TTTAAGCCGTTTGAGGAGCAGGTTGTGTCGGTGGTGGACCACTTCCTCGAGCTGGTGGCGGGTAAAGAATGA
Gene >Hirsu2|10245
ATGGCGGTCTATTGCGCCTCCAAGGCGCTAGGCTTCGAGGCCGTCAAGCGTTTGGGGGTCGAGCAGGAGCCGTCC
TTCGACATCGTTCACATCATGCCTTCATGGGTGCTCGGCCGTGATGATATGGTCCTGGCGGCCGAAGACATTTGC
AAAGGCACCAACGGCGTGCTCATGGGTCCCTTCTCGGCTGTGCTTCCCGAGCAGAGCTCGAAGGCACCACGGTGC
ACCTCGACGACATGGCCAAGATGCACGTCCTGGCCCTCGACAGCAAAGTCCAGGACGACCAGGAGTTCATGGCGG
CCTCCCCTGAGAGCACTGACTGGGCGGGGGCGTCTGATATAGCCAGAAAGCGTTATCTGAAGGAATGCGCGCGAG
GCATTTTTGGCTTCGACTCGATCCCAAGGCCGTTGACGCGCAAGCTCAGGATTGATAGCAGAAAGGCAGAGAAGA
CGTTTGGGTTTACCTTTAAGCCGTTTGAGGAGCAGGTTGTGTCGGTGGTGGACCACTTCCTCGAGCTGGTGGCGG
GTAAAGAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail