Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10244
Gene name
LocationContig_81:6056..7571
Strand-
Gene length (bp)1515
Transcript length (bp)1446
Coding sequence length (bp)1446
Protein length (aa) 482

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01490 Aa_trans Transmembrane amino acid transporter protein 2.1E-47 65 458

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P38680|MTR_NEUCR N amino acid transport system protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mtr PE=3 SV=2 30 480 4.0E-166

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

Domain # Start End Length
1 71 93 22
2 98 120 22
3 141 163 22
4 178 195 17
5 202 224 22
6 251 273 22
7 286 308 22
8 328 350 22
9 371 393 22
10 398 420 22
11 441 463 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10244
MGRPTSRTPAGPDRGFELDQWPRPGQGRPPPSEKQARDDVVVVGVGEVTDLDGEAARAADARFHRLGWKRLTVVL
IVESVALGALGLPAAFASLGMVLGVFFCVSLGLVAVYTGFLVGEVKLKYPQVAHYADSGRLLMGRFGYELFGAMF
VVSIIFVIGSHVLTGTIAFLKLTDNGGCSAAFGFLSAIILLVLAIPPSFADVAILGYIDFASILIAIGITIIATG
IQASDGPGLTAINWSWRPKPDLSFVEAFVAISNIAFAYTFVVGQFSFMDEMHTPSDYMKSIWSLGMIEISIYTLT
GAIIYAFVGVDVKSPALLSAGETVSKVAFGLALPVIFISGSINTTILGRYIQGRVLSKDSECHHVNTSKGWAIWL
GIVSAVTFTAYIIAELIPFFSPLLSLLASLFVSGFSYYFPALMWFKLLREGPWYASKNILSCLASGLTFVVGIVI
LICGSYASVADIIKRFTEGDVGEVFTCKPIG*
Coding >Hirsu2|10244
ATGGGTCGTCCGACCTCCCGTACCCCCGCCGGGCCGGACCGGGGATTCGAGCTCGACCAATGGCCGCGGCCGGGC
CAGGGCCGCCCCCCGCCGTCCGAGAAGCAGGCACGCGACGATGTTGTCGTCGTCGGCGTCGGCGAGGTCACCGAC
CTGGACGGTGAGGCCGCGCGCGCGGCCGATGCCCGCTTCCACCGCCTGGGCTGGAAGCGGCTGACCGTCGTCCTG
ATCGTCGAGAGCGTCGCGCTCGGCGCACTCGGCCTGCCGGCCGCCTTCGCCTCGCTCGGCATGGTCCTCGGCGTC
TTCTTCTGCGTCAGCCTCGGCCTCGTCGCCGTCTACACCGGCTTCCTCGTCGGCGAGGTCAAGCTCAAGTATCCC
CAGGTGGCCCACTATGCCGATAGCGGGCGTCTCCTTATGGGCAGGTTCGGCTACGAGCTCTTTGGCGCCATGTTC
GTCGTCTCCATCATCTTCGTCATCGGATCCCACGTCCTTACCGGCACCATCGCCTTCCTTAAGCTTACCGATAAC
GGTGGCTGCTCTGCTGCTTTTGGCTTTCTCTCTGCTATTATCCTACTAGTCCTGGCCATCCCGCCCTCTTTCGCC
GACGTCGCTATCCTCGGTTATATAGACTTTGCCTCTATCCTTATTGCTATCGGCATTACTATTATCGCTACCGGA
ATCCAGGCCAGCGACGGCCCAGGCCTTACAGCCATAAATTGGTCTTGGCGGCCGAAGCCCGACCTTAGCTTTGTC
GAAGCCTTTGTTGCCATTTCTAACATCGCCTTCGCCTATACCTTCGTCGTGGGCCAGTTCTCCTTTATGGACGAG
ATGCATACGCCGAGCGATTACATGAAGTCGATCTGGTCTCTCGGAATGATCGAGATCAGCATCTATACCTTGACC
GGCGCCATCATCTACGCCTTCGTAGGCGTCGACGTCAAGTCGCCGGCCCTCCTGTCGGCCGGGGAAACGGTGTCC
AAGGTGGCTTTCGGGCTTGCGTTGCCCGTTATTTTCATTTCCGGGTCCATCAACACCACAATCCTCGGCCGCTAC
ATCCAGGGCCGGGTCCTCAGCAAGGACTCGGAGTGTCACCACGTCAATACGTCGAAGGGCTGGGCCATCTGGCTG
GGCATTGTATCTGCCGTTACCTTCACGGCGTACATAATTGCCGAGCTCATCCCGTTCTTTTCCCCTCTACTCTCC
CTACTGGCCTCGCTCTTCGTTTCCGGCTTTTCCTACTACTTCCCCGCGTTGATGTGGTTCAAGCTCCTCCGCGAG
GGCCCCTGGTATGCGAGCAAGAACATTTTGAGCTGCCTCGCGTCCGGCCTTACCTTTGTCGTCGGCATAGTCATC
CTCATCTGTGGAAGTTATGCCAGTGTGGCCGACATTATCAAGAGGTTCACCGAGGGCGACGTCGGCGAGGTTTTC
ACCTGCAAACCTATTGGATAG
Transcript >Hirsu2|10244
ATGGGTCGTCCGACCTCCCGTACCCCCGCCGGGCCGGACCGGGGATTCGAGCTCGACCAATGGCCGCGGCCGGGC
CAGGGCCGCCCCCCGCCGTCCGAGAAGCAGGCACGCGACGATGTTGTCGTCGTCGGCGTCGGCGAGGTCACCGAC
CTGGACGGTGAGGCCGCGCGCGCGGCCGATGCCCGCTTCCACCGCCTGGGCTGGAAGCGGCTGACCGTCGTCCTG
ATCGTCGAGAGCGTCGCGCTCGGCGCACTCGGCCTGCCGGCCGCCTTCGCCTCGCTCGGCATGGTCCTCGGCGTC
TTCTTCTGCGTCAGCCTCGGCCTCGTCGCCGTCTACACCGGCTTCCTCGTCGGCGAGGTCAAGCTCAAGTATCCC
CAGGTGGCCCACTATGCCGATAGCGGGCGTCTCCTTATGGGCAGGTTCGGCTACGAGCTCTTTGGCGCCATGTTC
GTCGTCTCCATCATCTTCGTCATCGGATCCCACGTCCTTACCGGCACCATCGCCTTCCTTAAGCTTACCGATAAC
GGTGGCTGCTCTGCTGCTTTTGGCTTTCTCTCTGCTATTATCCTACTAGTCCTGGCCATCCCGCCCTCTTTCGCC
GACGTCGCTATCCTCGGTTATATAGACTTTGCCTCTATCCTTATTGCTATCGGCATTACTATTATCGCTACCGGA
ATCCAGGCCAGCGACGGCCCAGGCCTTACAGCCATAAATTGGTCTTGGCGGCCGAAGCCCGACCTTAGCTTTGTC
GAAGCCTTTGTTGCCATTTCTAACATCGCCTTCGCCTATACCTTCGTCGTGGGCCAGTTCTCCTTTATGGACGAG
ATGCATACGCCGAGCGATTACATGAAGTCGATCTGGTCTCTCGGAATGATCGAGATCAGCATCTATACCTTGACC
GGCGCCATCATCTACGCCTTCGTAGGCGTCGACGTCAAGTCGCCGGCCCTCCTGTCGGCCGGGGAAACGGTGTCC
AAGGTGGCTTTCGGGCTTGCGTTGCCCGTTATTTTCATTTCCGGGTCCATCAACACCACAATCCTCGGCCGCTAC
ATCCAGGGCCGGGTCCTCAGCAAGGACTCGGAGTGTCACCACGTCAATACGTCGAAGGGCTGGGCCATCTGGCTG
GGCATTGTATCTGCCGTTACCTTCACGGCGTACATAATTGCCGAGCTCATCCCGTTCTTTTCCCCTCTACTCTCC
CTACTGGCCTCGCTCTTCGTTTCCGGCTTTTCCTACTACTTCCCCGCGTTGATGTGGTTCAAGCTCCTCCGCGAG
GGCCCCTGGTATGCGAGCAAGAACATTTTGAGCTGCCTCGCGTCCGGCCTTACCTTTGTCGTCGGCATAGTCATC
CTCATCTGTGGAAGTTATGCCAGTGTGGCCGACATTATCAAGAGGTTCACCGAGGGCGACGTCGGCGAGGTTTTC
ACCTGCAAACCTATTGGATAG
Gene >Hirsu2|10244
ATGGGTCGTCCGACCTCCCGTACCCCCGCCGGGCCGGACCGGGGATTCGAGCTCGACCAATGGCCGCGGCCGGGC
CAGGGCCGCCCCCCGCCGTCCGAGAAGCAGGCACGCGACGATGTTGTCGTCGTCGGCGTCGGCGAGGTCACCGAC
CTGGACGGTGAGGCCGCGCGCGCGGCCGATGCCCGCTTCCACCGCCTGGGCTGGAAGCGGCTGACCGTCGTCCTG
ATCGTCGAGAGCGTCGCGCTCGGCGCACTCGGCCTGCCGGCCGCCTTCGCCTCGCTCGGCATGGTCCTCGGCGTC
TTCTTCTGCGTCAGCCTCGGCCTCGTCGCCGTCTACACCGGCTTCCTCGTCGGCGAGGTCAAGCTCAAGTATCCC
CAGGTGGCCCACTATGCCGATAGCGGGCGTCTCCTTATGGGCAGGTTCGGCTACGAGCTCTTTGGCGCCATGTTC
GTCGTCTCCATCATCTTCGTCATCGGATCCCACGTCCTTACCGGCACCATCGCCTTCCTTAAGCTTACCGATAAC
GGTGGCTGCTCTGCTGCTTTTGGCTTTCTCTCTGCTATTATCCTACTAGTCCTGGCCATCCCGCCCTCTTTCGCC
GACGTCGCTATCCTCGGTTATATAGACTTTGCCTCTATCCTTATTGCTATCGGCATTACTATTATCGCTACCGGA
ATCCAGGCCAGCGACGGCCCAGGCCTTACAGCCATAAATTGGTCTTGGCGGCCGAAGCCCGACCTTAGCTTTGTC
GAAGCCTTTGTTGCCATTTCTAACATCGCCTTCGCCTATACCTTCGTCGTGGGCCAGTTCTCCTTTATGGACGAG
ATGCATACGCCGAGCGATTACATGAAGTCGATCTGGTCTCTCGGAATGATCGAGATCAGCATCTATACCTTGACC
GGCGCCATCATCTACGCCTTCGTAGGCGTCGACGTCAAGTCGCCGGCCCTCCTGTCGGCCGGGGAAACGGTGTCC
AAGGTGGCTTTCGGGCTTGCGTTGCCCGTTATTTTCATTTCCGGGTCCATCAACACCACAATCCTCGGCCGCTAC
ATCCAGGGCCGGGTCCTCAGCAAGGACTCGGAGTGTCACCACGTCAATACGTCGAAGGGCTGGGCCATCTGGCTG
GGCATTGTATCTGCCGTTACCTTCACGGCGTACATAATTGCCGAGCTCATCCCGTTCTTTTCCCCTCTACTCTCC
CTACTGGCCTCGCTCTTCGTTTCCGGCTTTTCCTACTACTTCCCCGCGTTGATGTGGTTCAAGCTCCTCCGCGAG
GGCCCCTGGTATGCGAGCAAGAACATTTTGAGCTGCCTCGCGTCCGGCCTTACCTTTGTCGTCGGCATAGTCATC
CTCATCTGTGGAAGTTATGCCAGTGTGGCCGACATTGTGAGTCTCGTTACCGCCGGCCCGATGGGATCCCTCTCC
GCTGCAATACTGACTGGCCGACGCGTCTAGATCAAGAGGTTCACCGAGGGCGACGTCGGCGAGGTTTTCACCTGC
AAACCTATTGGATAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail