Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10234
Gene name
LocationContig_807:6729..11083
Strand+
Gene length (bp)4354
Transcript length (bp)4014
Coding sequence length (bp)4014
Protein length (aa) 1338

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00773 RNB RNB domain 4.1E-75 719 1052
PF17849 OB_Dis3 Dis3-like cold-shock domain 2 (CSD2) 2.4E-25 612 687
PF17877 Dis3l2_C_term DIS3-like exonuclease 2 C terminal 6.2E-25 1104 1187

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P24276|SSD1_YEAST Protein SSD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSD1 PE=1 SV=1 375 1335 0.0E+00
sp|Q5AK62|SSD1_CANAL Virulence protein SSD1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SSD1 PE=2 SV=1 390 1336 0.0E+00
sp|O74454|STS5_SCHPO Protein sts5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sts5 PE=1 SV=1 390 1159 1.0E-143
sp|O94525|YBU1_SCHPO Uncharacterized ribonuclease C609.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC609.01 PE=3 SV=1 388 1156 7.0E-140
sp|Q8IYB7|DI3L2_HUMAN DIS3-like exonuclease 2 OS=Homo sapiens GN=DIS3L2 PE=1 SV=4 369 1157 3.0E-96
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P24276|SSD1_YEAST Protein SSD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSD1 PE=1 SV=1 375 1335 0.0E+00
sp|Q5AK62|SSD1_CANAL Virulence protein SSD1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SSD1 PE=2 SV=1 390 1336 0.0E+00
sp|O74454|STS5_SCHPO Protein sts5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sts5 PE=1 SV=1 390 1159 1.0E-143
sp|O94525|YBU1_SCHPO Uncharacterized ribonuclease C609.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC609.01 PE=3 SV=1 388 1156 7.0E-140
sp|Q8IYB7|DI3L2_HUMAN DIS3-like exonuclease 2 OS=Homo sapiens GN=DIS3L2 PE=1 SV=4 369 1157 3.0E-96
sp|Q0V9R3|DI3L2_XENTR DIS3-like exonuclease 2 OS=Xenopus tropicalis GN=dis3l2 PE=2 SV=2 393 1157 6.0E-92
sp|Q8CI75|DI3L2_MOUSE DIS3-like exonuclease 2 OS=Mus musculus GN=Dis3l2 PE=1 SV=1 389 1157 1.0E-91
sp|Q09568|DI3L2_CAEEL DIS3-like exonuclease 2 OS=Caenorhabditis elegans GN=F48E8.6 PE=3 SV=2 391 1184 8.0E-87
sp|O14040|DI3L2_SCHPO DIS3-like exonuclease 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dis32 PE=1 SV=1 526 1133 9.0E-80
sp|Q9SHL7|RP44A_ARATH Exosome complex exonuclease RRP44 homolog A OS=Arabidopsis thaliana GN=RRP44A PE=2 SV=2 389 1134 1.0E-70
sp|P0DM58|DI3L2_ARATH DIS3-like exonuclease 2 OS=Arabidopsis thaliana GN=SOV PE=1 SV=1 359 1159 3.0E-67
sp|Q0WPN0|DI32L_ARATH Inactive exonuclease DIS3L2 OS=Arabidopsis thaliana GN=SOV PE=2 SV=1 359 1159 5.0E-66
sp|A0JN80|DI3L1_BOVIN DIS3-like exonuclease 1 OS=Bos taurus GN=DIS3L PE=2 SV=2 616 1130 1.0E-64
sp|Q8C0S1|DI3L1_MOUSE DIS3-like exonuclease 1 OS=Mus musculus GN=Dis3l PE=1 SV=2 616 1130 2.0E-64
sp|Q5U2P0|DI3L1_RAT DIS3-like exonuclease 1 OS=Rattus norvegicus GN=Dis3l PE=2 SV=2 616 1130 2.0E-64
sp|Q8TF46|DI3L1_HUMAN DIS3-like exonuclease 1 OS=Homo sapiens GN=DIS3L PE=1 SV=2 616 1130 8.0E-64
sp|Q5R5N8|DI3L1_PONAB DIS3-like exonuclease 1 OS=Pongo abelii GN=DIS3L PE=2 SV=1 616 1130 9.0E-64
sp|A2RV18|DI3L1_DANRE DIS3-like exonuclease 1 OS=Danio rerio GN=dis3l PE=2 SV=1 603 1134 3.0E-63
sp|Q9CSH3|RRP44_MOUSE Exosome complex exonuclease RRP44 OS=Mus musculus GN=Dis3 PE=1 SV=4 614 1133 6.0E-63
sp|Q9Y2L1|RRP44_HUMAN Exosome complex exonuclease RRP44 OS=Homo sapiens GN=DIS3 PE=1 SV=2 614 1162 5.0E-61
sp|Q0P4R5|DI3L1_XENTR DIS3-like exonuclease 1 OS=Xenopus tropicalis GN=dis3l PE=2 SV=2 612 1130 5.0E-60
sp|Q08162|RRP44_YEAST Exosome complex exonuclease DIS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DIS3 PE=1 SV=1 394 1138 6.0E-60
sp|Q17632|RRP44_CAEEL Probable exosome complex exonuclease RRP44 OS=Caenorhabditis elegans GN=dis-3 PE=3 SV=2 376 1133 6.0E-59
sp|Q6GN11|DI3L1_XENLA DIS3-like exonuclease 1 OS=Xenopus laevis GN=dis3l PE=2 SV=2 612 1130 6.0E-59
sp|P37202|DIS3_SCHPO Exosome complex exonuclease dis3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dis3 PE=1 SV=1 612 1138 3.0E-57
sp|O32231|RNR_BACSU Ribonuclease R OS=Bacillus subtilis (strain 168) GN=rnr PE=2 SV=1 712 1104 2.0E-43
sp|Q9WZI1|RNR_THEMA Ribonuclease R OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=rnr PE=3 SV=1 648 1138 1.0E-42
sp|O84402|RNR_CHLTR Ribonuclease R OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=rnr PE=3 SV=1 665 1191 3.0E-40
sp|Q9PK00|RNR_CHLMU Ribonuclease R OS=Chlamydia muridarum (strain MoPn / Nigg) GN=rnr PE=3 SV=1 665 1164 5.0E-38
sp|Q9CH00|RNR1_LACLA Ribonuclease R 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=rnr1 PE=3 SV=1 713 1158 7.0E-38
sp|Q9Z848|RNR_CHLPN Ribonuclease R OS=Chlamydia pneumoniae GN=rnr PE=3 SV=1 665 1139 3.0E-36
sp|O67834|RNR_AQUAE Ribonuclease R OS=Aquifex aeolicus (strain VF5) GN=rnr PE=3 SV=1 646 1095 1.0E-30
sp|Q02146|RNR2_LACLA Ribonuclease R 2 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=rnr2 PE=3 SV=3 688 1047 3.0E-29
sp|P40611|RNR_VIBPA Ribonuclease R OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=rnr PE=3 SV=2 662 1145 1.0E-25
sp|Q9PR88|RNR_UREPA Ribonuclease R OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=rnr PE=3 SV=1 712 1089 6.0E-25
sp|P75529|RNR_MYCPN Ribonuclease R OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=rnr PE=3 SV=1 711 1047 1.0E-23
sp|Q98QL0|RNR_MYCPU Ribonuclease R OS=Mycoplasma pulmonis (strain UAB CTIP) GN=rnr PE=3 SV=1 713 1048 2.0E-23
sp|P47350|RNR_MYCGE Ribonuclease R OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=rnr PE=3 SV=1 669 1153 2.0E-23
sp|Q9KNY1|RNR_VIBCH Ribonuclease R OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rnr PE=3 SV=1 713 1138 3.0E-23
sp|P21499|RNR_ECOLI Ribonuclease R OS=Escherichia coli (strain K12) GN=rnr PE=1 SV=2 713 1138 2.0E-22
sp|P30851|RNR_SHIFL Ribonuclease R OS=Shigella flexneri GN=rnr PE=3 SV=4 713 1138 5.0E-22
sp|Q46363|ZAM_SYNY3 Acetazolamide conferring resistance protein zam OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=zam PE=3 SV=1 643 1152 2.0E-21
sp|P44907|RNR_HAEIN Ribonuclease R OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rnr PE=3 SV=1 661 1053 2.0E-19
sp|Q8K917|RNR_BUCAP Ribonuclease R OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=rnr PE=3 SV=1 663 1138 3.0E-19
sp|P57628|RNR_BUCAI Ribonuclease R OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=rnr PE=3 SV=2 710 1138 5.0E-19
sp|Q7MEL4|RNB_VIBVY Exoribonuclease 2 OS=Vibrio vulnificus (strain YJ016) GN=rnb PE=3 SV=2 702 1051 3.0E-15
sp|Q8D7K6|RNB_VIBVU Exoribonuclease 2 OS=Vibrio vulnificus (strain CMCP6) GN=rnb PE=3 SV=1 702 1051 1.0E-14
sp|Q87IJ9|RNB_VIBPA Exoribonuclease 2 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=rnb PE=3 SV=1 702 1051 2.0E-14
sp|B7VSB8|RNB_VIBTL Exoribonuclease 2 OS=Vibrio tasmaniensis (strain LGP32) GN=rnb PE=3 SV=1 702 1049 2.0E-13
sp|Q2NST6|RNB_SODGM Exoribonuclease 2 OS=Sodalis glossinidius (strain morsitans) GN=rnb PE=3 SV=1 718 1057 3.0E-13
sp|E9QAM5|HELZ2_MOUSE Helicase with zinc finger domain 2 OS=Mus musculus GN=Helz2 PE=1 SV=1 638 1051 4.0E-13
sp|A1SWZ6|RNB_PSYIN Exoribonuclease 2 OS=Psychromonas ingrahamii (strain 37) GN=rnb PE=3 SV=1 718 1069 4.0E-13
sp|C3LW69|RNB_VIBCM Exoribonuclease 2 OS=Vibrio cholerae serotype O1 (strain M66-2) GN=rnb PE=3 SV=1 702 1061 2.0E-12
sp|Q9KLE1|RNB_VIBCH Exoribonuclease 2 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rnb PE=3 SV=1 702 1061 2.0E-12
sp|A5F0G1|RNB_VIBC3 Exoribonuclease 2 OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=rnb PE=3 SV=1 702 1061 5.0E-12
sp|B5XS03|RNB_KLEP3 Exoribonuclease 2 OS=Klebsiella pneumoniae (strain 342) GN=rnb PE=3 SV=1 687 1051 1.0E-11
sp|Q9BYK8|HELZ2_HUMAN Helicase with zinc finger domain 2 OS=Homo sapiens GN=HELZ2 PE=1 SV=6 716 1089 4.0E-11
sp|Q6NQJ6|RNR1_ARATH Ribonuclease II, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=RNR1 PE=2 SV=1 707 814 7.0E-11
sp|D3V184|RNB_XENBS Exoribonuclease 2 OS=Xenorhabdus bovienii (strain SS-2004) GN=rnb PE=3 SV=1 719 1053 1.0E-10
sp|P56123|RNR_HELPY Ribonuclease R OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=rnr PE=3 SV=1 754 1051 1.0E-10
sp|Q7N4F5|RNB_PHOLL Exoribonuclease 2 OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=rnb PE=3 SV=1 719 1057 3.0E-10
sp|Q9ZJX9|RNR_HELPJ Ribonuclease R OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=rnr PE=3 SV=1 719 1051 5.0E-10
sp|P73177|RN2H_SYNY3 Uncharacterized ribonuclease sll1290 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll1290 PE=3 SV=1 719 852 1.0E-09
sp|P54084|RNR_ACIFR Ribonuclease R (Fragment) OS=Acidithiobacillus ferrooxidans GN=rnr PE=3 SV=2 616 812 1.0E-08
sp|B0BP37|RNB_ACTPJ Exoribonuclease 2 OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=rnb PE=3 SV=1 719 1051 8.0E-07
sp|B3GXJ4|RNB_ACTP7 Exoribonuclease 2 OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=rnb PE=3 SV=1 719 1051 8.0E-07
sp|A2RV18|DI3L1_DANRE DIS3-like exonuclease 1 OS=Danio rerio GN=dis3l PE=2 SV=1 376 468 2.0E-06
sp|A3N0B9|RNB_ACTP2 Exoribonuclease 2 OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=rnb PE=3 SV=1 719 1051 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0004540 ribonuclease activity Yes
GO:0140098 catalytic activity, acting on RNA No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No
GO:0004518 nuclease activity No
GO:0003824 catalytic activity No
GO:0005488 binding No
GO:0016787 hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10234
MEQQQPPQQPAQQQQQPKPQQQPPAGGVPGPTGRRLHIAHRRSPSELTPLMSMFANPGMEQLAIQQQIELLQQQQ
QQIQATHQQYVNLGMMPPGQPIAHNGAFNPLQPMANMSQTAFQFPNQMPQQNMSMGPPTQPLSHRRNQSALPNMG
AHGRENTGGRGGRGGGGGSGHQRRHSLALADAKKAAELAQQKRTTTGFQFPGPNASADKPDDENTKGSSQSTLDA
SVAQGSTRGRGGHGRSQSMASNGRGGRMGGDGGGDFQRRGGGMGHARTGSRNYEGNWRTQNQNQDQSGGAGQSQP
FQPGHRSRGSMNQSVSSIGAFQYNPNQPQLMQVPGQMMMPSMYGQQLNPMQLGQLQALQAAQMNGQQFSGLASSQ
HAGSGGGQQQQQQQRKTLFTPYLPQASLPALLGDGQLVSGILRVNKKNRSDAYVTTQDGLLDADIFICGSKDRNR
ALEGDLVAVELLDVDEVWSQKREKEEKKKRKDITDTRSGSTNQSSQNSGQNDDGNAPEGGIRRRGSLRQRPTQKK
NDDVEVEGQSLLLVEEEEISDEQKPLYAGHIVAVIERVAGQMFSGTLGLLRPSSQATKEKQEAERAARDGGNSRH
NDSRQQEKPKIVWFKPTDKRVPLIAIPTEQAPRDFVEKHQDYADRIFVACIKRWPITSLHPFGTLVEQLGRMGDL
KVETDALLRDNNFSSDEFSDAVLRNVGLQDWSLAKEDEEAVASRRDFRQETVFTIDFNGGSELGNGIHVKTRPDG
KIEIGVHVPDVAHFVKPNSLVDREAKKRGTSVQLLNRFCALLPPKLSGEVCSLGQDEERLAVSVVFNVNPHSGSV
AEGDSWVGRSVVKSSGKVSLADMDNALKDASTFANGTVSVNTIQILQGVSQKFREGRLGAGGEPIAPLRLFQQLD
DENNPVEDNIFNSSPALEMIEELMHRANAHVAQRLAAGLPEKALLRRQAAPNPRRLQTFVERMTALGYEIDASSS
GALQNSLFKVDDTDLRKGMETLVLKSMHRAKYFIAGKTTKALWPHYSLNLPLYTHFTSPTRRYADIVVHRQLEAV
LSEGKIEFTDDMENLVKTAEACNTKKDSAQNAQEQSIHIESCRTMDKKRQEANGELIAEGIVLCVYESAFDVLIP
EWGFEKRVHCDQLPLKKAEFRKEKRVLELYWEKGVPSSAFVPEDERPKAAASQRMTNAMAAAKQAEEAERVKRER
EEAARKQTETGTMSTDDVDALFDDDDDDNTSDVTEAMAGVSLAERPTQSVPGSPARTSSNAGTLHRTRSDSKVPV
SEAVEAGLTNKEKYLKLFELREEGGDYIQDVTEMRKLPIILKTDLSKSPPCLTIRCLNPYAL*
Coding >Hirsu2|10234
ATGGAGCAGCAGCAGCCGCCCCAGCAGCCGGCGCAACAGCAGCAGCAGCCGAAGCCGCAGCAGCAGCCGCCGGCC
GGTGGTGTCCCTGGGCCTACCGGACGACGGCTGCACATTGCCCACCGACGCAGCCCGTCAGAGCTAACACCGTTG
ATGAGCATGTTTGCCAACCCAGGAATGGAACAGTTGGCCATCCAGCAACAGATTGAGCTCTTGCAGCAGCAACAG
CAGCAAATCCAGGCGACTCACCAACAATATGTCAACCTGGGCATGATGCCACCCGGCCAGCCCATTGCCCACAAC
GGAGCGTTCAATCCTTTGCAGCCCATGGCCAACATGTCCCAAACGGCCTTCCAATTCCCCAACCAGATGCCGCAA
CAAAATATGTCGATGGGTCCTCCTACCCAGCCATTGTCACATCGCCGTAATCAGTCGGCACTGCCAAACATGGGC
GCCCATGGGCGAGAGAACACCGGCGGGCGAGGCGGGCGAGGCGGCGGCGGCGGCTCCGGCCACCAGCGAAGGCAC
TCCTTGGCCCTGGCCGACGCCAAGAAAGCCGCCGAGCTTGCCCAGCAGAAACGAACGACGACGGGCTTTCAGTTC
CCCGGCCCCAATGCCTCCGCCGACAAGCCCGACGACGAGAACACCAAGGGGTCGTCTCAGTCGACGCTCGATGCC
TCCGTCGCTCAGGGCTCGACTCGTGGCCGCGGAGGTCACGGCCGCAGCCAGAGCATGGCCTCCAACGGACGCGGC
GGTCGCATGGGCGGCGACGGCGGCGGCGATTTCCAGCGCCGCGGCGGCGGCATGGGCCACGCCCGCACCGGATCT
CGAAACTACGAGGGTAACTGGCGCACCCAGAACCAGAACCAAGACCAGTCGGGCGGCGCCGGCCAGTCCCAGCCG
TTTCAGCCGGGCCACCGGTCCCGAGGTTCCATGAACCAGTCCGTCTCCTCGATCGGGGCTTTCCAGTACAACCCC
AACCAACCCCAGCTCATGCAGGTCCCGGGCCAGATGATGATGCCCTCGATGTACGGCCAGCAGCTCAACCCCATG
CAGCTCGGCCAGCTACAAGCCCTGCAGGCGGCACAGATGAACGGCCAGCAGTTTTCGGGTCTCGCGAGCTCCCAG
CACGCGGGCTCCGGCGGCGGGCAGCAGCAGCAGCAGCAGCAGCGCAAGACGCTCTTCACCCCCTACCTCCCCCAG
GCTTCGCTGCCCGCCCTTCTCGGAGACGGCCAGCTCGTCTCCGGCATCCTGCGCGTGAACAAGAAGAACCGAAGT
GACGCCTACGTCACGACGCAAGACGGCCTCCTGGATGCCGACATCTTCATCTGCGGCAGCAAGGATCGCAACCGC
GCCCTTGAGGGCGACCTTGTCGCCGTAGAGCTGCTGGACGTCGATGAAGTTTGGTCCCAGAAGAGGGAGAAGGAG
GAGAAGAAGAAGCGTAAAGACATCACTGACACGCGTTCTGGCTCCACGAACCAATCCAGCCAGAATTCCGGCCAA
AATGACGACGGCAACGCCCCCGAGGGTGGCATCCGCCGCCGCGGCAGCCTGCGCCAGCGGCCGACCCAGAAGAAG
AACGACGATGTCGAGGTGGAGGGCCAGAGTCTACTTCTCGTCGAGGAAGAAGAGATCAGCGATGAGCAGAAGCCG
CTTTATGCCGGCCACATTGTCGCCGTCATCGAGCGCGTTGCCGGCCAGATGTTCTCCGGCACGCTCGGCCTCTTG
CGCCCCAGCAGTCAGGCGACCAAGGAGAAGCAAGAGGCCGAGAGGGCCGCCCGCGACGGCGGCAACAGCCGTCAC
AACGACTCCCGCCAGCAGGAGAAGCCCAAGATTGTCTGGTTTAAGCCCACGGACAAGCGCGTCCCTCTGATTGCC
ATTCCCACGGAGCAGGCCCCCCGCGATTTCGTTGAGAAGCACCAAGACTATGCCGACCGGATCTTTGTCGCCTGC
ATCAAGCGATGGCCAATCACGTCCCTGCACCCCTTCGGCACTCTGGTGGAGCAGCTCGGACGCATGGGCGACCTC
AAGGTGGAGACCGATGCCCTGCTCCGAGACAACAATTTCTCCTCGGACGAGTTCTCCGACGCCGTCCTGCGCAAC
GTCGGCCTCCAGGACTGGTCGTTGGCCAAGGAGGACGAAGAGGCCGTCGCCTCCCGTCGCGACTTCCGCCAGGAG
ACCGTCTTCACGATCGACTTCAACGGAGGCTCGGAGCTCGGCAACGGAATCCACGTCAAGACTCGCCCCGACGGC
AAGATCGAGATTGGAGTCCACGTGCCCGACGTCGCGCACTTCGTGAAGCCCAACTCTCTGGTAGACCGCGAGGCC
AAGAAGCGCGGCACCTCGGTCCAGCTGCTCAACCGGTTCTGTGCACTGCTGCCCCCGAAGCTGTCCGGCGAGGTT
TGCTCCCTCGGCCAGGACGAGGAGCGGCTGGCGGTCAGCGTCGTGTTCAACGTGAATCCCCACAGCGGCTCCGTC
GCCGAGGGCGACAGCTGGGTGGGCCGAAGCGTCGTCAAGAGCAGCGGCAAGGTGTCGTTGGCCGACATGGACAAC
GCTCTCAAGGACGCCTCGACATTCGCCAACGGGACCGTGTCGGTGAACACGATTCAGATCCTCCAGGGGGTGTCG
CAGAAATTCCGGGAGGGCCGCTTGGGCGCGGGGGGCGAGCCGATTGCACCGCTGCGGCTCTTCCAGCAGCTGGAC
GACGAGAACAATCCGGTGGAGGATAACATCTTCAACTCGAGCCCGGCGCTGGAGATGATTGAGGAGCTCATGCAC
AGGGCCAACGCGCACGTGGCGCAGCGTCTGGCGGCGGGTCTGCCGGAGAAGGCGCTCCTCCGCCGCCAGGCCGCG
CCCAACCCGCGGCGCCTCCAGACTTTCGTCGAGCGCATGACGGCGCTGGGCTACGAAATCGACGCATCCAGCAGC
GGAGCCCTGCAGAACAGTCTGTTCAAGGTGGACGACACGGATCTTCGCAAGGGCATGGAGACGCTGGTCCTCAAG
TCGATGCACAGAGCCAAGTACTTCATTGCGGGCAAGACGACGAAGGCGCTCTGGCCGCACTACTCCCTGAACCTG
CCCCTGTACACGCACTTCACATCGCCCACCCGTCGCTACGCGGACATTGTGGTGCACCGGCAGCTGGAGGCGGTG
CTGTCGGAGGGCAAGATTGAGTTTACGGACGACATGGAGAATCTTGTCAAGACGGCTGAGGCGTGCAACACCAAG
AAGGACTCGGCACAGAACGCGCAGGAGCAGAGCATCCACATCGAATCCTGCCGCACCATGGACAAGAAGCGGCAG
GAGGCCAACGGGGAGCTGATCGCGGAAGGAATCGTGCTGTGCGTGTACGAGTCGGCCTTTGACGTGCTCATTCCC
GAGTGGGGCTTCGAGAAGCGGGTGCACTGCGATCAGCTGCCGCTCAAGAAGGCCGAGTTCAGGAAAGAGAAGAGG
GTGCTCGAACTGTACTGGGAGAAGGGCGTGCCCAGCTCGGCCTTCGTGCCGGAGGACGAACGGCCCAAGGCGGCG
GCGTCGCAGAGAATGACCAACGCGATGGCGGCGGCGAAGCAGGCGGAGGAGGCGGAGCGGGTCAAGCGGGAGCGG
GAGGAGGCGGCGCGCAAGCAGACGGAGACGGGAACCATGTCGACGGACGACGTGGACGCCCTGTTCGACGACGAC
GACGACGACAACACGTCGGACGTGACGGAGGCCATGGCCGGCGTGTCGCTGGCGGAGCGGCCGACGCAGAGCGTC
CCCGGGTCCCCGGCACGCACGTCATCGAATGCCGGCACGCTGCACCGGACGCGCTCCGACTCCAAGGTGCCCGTC
TCGGAAGCGGTCGAGGCGGGCCTGACGAACAAGGAAAAGTACCTGAAGCTGTTTGAGCTTCGCGAGGAAGGCGGG
GATTACATCCAGGACGTGACGGAGATGAGGAAGTTGCCGATCATCCTGAAGACGGATCTCAGCAAGAGCCCACCC
TGCTTGACGATCCGGTGCTTGAACCCGTATGCGCTATGA
Transcript >Hirsu2|10234
ATGGAGCAGCAGCAGCCGCCCCAGCAGCCGGCGCAACAGCAGCAGCAGCCGAAGCCGCAGCAGCAGCCGCCGGCC
GGTGGTGTCCCTGGGCCTACCGGACGACGGCTGCACATTGCCCACCGACGCAGCCCGTCAGAGCTAACACCGTTG
ATGAGCATGTTTGCCAACCCAGGAATGGAACAGTTGGCCATCCAGCAACAGATTGAGCTCTTGCAGCAGCAACAG
CAGCAAATCCAGGCGACTCACCAACAATATGTCAACCTGGGCATGATGCCACCCGGCCAGCCCATTGCCCACAAC
GGAGCGTTCAATCCTTTGCAGCCCATGGCCAACATGTCCCAAACGGCCTTCCAATTCCCCAACCAGATGCCGCAA
CAAAATATGTCGATGGGTCCTCCTACCCAGCCATTGTCACATCGCCGTAATCAGTCGGCACTGCCAAACATGGGC
GCCCATGGGCGAGAGAACACCGGCGGGCGAGGCGGGCGAGGCGGCGGCGGCGGCTCCGGCCACCAGCGAAGGCAC
TCCTTGGCCCTGGCCGACGCCAAGAAAGCCGCCGAGCTTGCCCAGCAGAAACGAACGACGACGGGCTTTCAGTTC
CCCGGCCCCAATGCCTCCGCCGACAAGCCCGACGACGAGAACACCAAGGGGTCGTCTCAGTCGACGCTCGATGCC
TCCGTCGCTCAGGGCTCGACTCGTGGCCGCGGAGGTCACGGCCGCAGCCAGAGCATGGCCTCCAACGGACGCGGC
GGTCGCATGGGCGGCGACGGCGGCGGCGATTTCCAGCGCCGCGGCGGCGGCATGGGCCACGCCCGCACCGGATCT
CGAAACTACGAGGGTAACTGGCGCACCCAGAACCAGAACCAAGACCAGTCGGGCGGCGCCGGCCAGTCCCAGCCG
TTTCAGCCGGGCCACCGGTCCCGAGGTTCCATGAACCAGTCCGTCTCCTCGATCGGGGCTTTCCAGTACAACCCC
AACCAACCCCAGCTCATGCAGGTCCCGGGCCAGATGATGATGCCCTCGATGTACGGCCAGCAGCTCAACCCCATG
CAGCTCGGCCAGCTACAAGCCCTGCAGGCGGCACAGATGAACGGCCAGCAGTTTTCGGGTCTCGCGAGCTCCCAG
CACGCGGGCTCCGGCGGCGGGCAGCAGCAGCAGCAGCAGCAGCGCAAGACGCTCTTCACCCCCTACCTCCCCCAG
GCTTCGCTGCCCGCCCTTCTCGGAGACGGCCAGCTCGTCTCCGGCATCCTGCGCGTGAACAAGAAGAACCGAAGT
GACGCCTACGTCACGACGCAAGACGGCCTCCTGGATGCCGACATCTTCATCTGCGGCAGCAAGGATCGCAACCGC
GCCCTTGAGGGCGACCTTGTCGCCGTAGAGCTGCTGGACGTCGATGAAGTTTGGTCCCAGAAGAGGGAGAAGGAG
GAGAAGAAGAAGCGTAAAGACATCACTGACACGCGTTCTGGCTCCACGAACCAATCCAGCCAGAATTCCGGCCAA
AATGACGACGGCAACGCCCCCGAGGGTGGCATCCGCCGCCGCGGCAGCCTGCGCCAGCGGCCGACCCAGAAGAAG
AACGACGATGTCGAGGTGGAGGGCCAGAGTCTACTTCTCGTCGAGGAAGAAGAGATCAGCGATGAGCAGAAGCCG
CTTTATGCCGGCCACATTGTCGCCGTCATCGAGCGCGTTGCCGGCCAGATGTTCTCCGGCACGCTCGGCCTCTTG
CGCCCCAGCAGTCAGGCGACCAAGGAGAAGCAAGAGGCCGAGAGGGCCGCCCGCGACGGCGGCAACAGCCGTCAC
AACGACTCCCGCCAGCAGGAGAAGCCCAAGATTGTCTGGTTTAAGCCCACGGACAAGCGCGTCCCTCTGATTGCC
ATTCCCACGGAGCAGGCCCCCCGCGATTTCGTTGAGAAGCACCAAGACTATGCCGACCGGATCTTTGTCGCCTGC
ATCAAGCGATGGCCAATCACGTCCCTGCACCCCTTCGGCACTCTGGTGGAGCAGCTCGGACGCATGGGCGACCTC
AAGGTGGAGACCGATGCCCTGCTCCGAGACAACAATTTCTCCTCGGACGAGTTCTCCGACGCCGTCCTGCGCAAC
GTCGGCCTCCAGGACTGGTCGTTGGCCAAGGAGGACGAAGAGGCCGTCGCCTCCCGTCGCGACTTCCGCCAGGAG
ACCGTCTTCACGATCGACTTCAACGGAGGCTCGGAGCTCGGCAACGGAATCCACGTCAAGACTCGCCCCGACGGC
AAGATCGAGATTGGAGTCCACGTGCCCGACGTCGCGCACTTCGTGAAGCCCAACTCTCTGGTAGACCGCGAGGCC
AAGAAGCGCGGCACCTCGGTCCAGCTGCTCAACCGGTTCTGTGCACTGCTGCCCCCGAAGCTGTCCGGCGAGGTT
TGCTCCCTCGGCCAGGACGAGGAGCGGCTGGCGGTCAGCGTCGTGTTCAACGTGAATCCCCACAGCGGCTCCGTC
GCCGAGGGCGACAGCTGGGTGGGCCGAAGCGTCGTCAAGAGCAGCGGCAAGGTGTCGTTGGCCGACATGGACAAC
GCTCTCAAGGACGCCTCGACATTCGCCAACGGGACCGTGTCGGTGAACACGATTCAGATCCTCCAGGGGGTGTCG
CAGAAATTCCGGGAGGGCCGCTTGGGCGCGGGGGGCGAGCCGATTGCACCGCTGCGGCTCTTCCAGCAGCTGGAC
GACGAGAACAATCCGGTGGAGGATAACATCTTCAACTCGAGCCCGGCGCTGGAGATGATTGAGGAGCTCATGCAC
AGGGCCAACGCGCACGTGGCGCAGCGTCTGGCGGCGGGTCTGCCGGAGAAGGCGCTCCTCCGCCGCCAGGCCGCG
CCCAACCCGCGGCGCCTCCAGACTTTCGTCGAGCGCATGACGGCGCTGGGCTACGAAATCGACGCATCCAGCAGC
GGAGCCCTGCAGAACAGTCTGTTCAAGGTGGACGACACGGATCTTCGCAAGGGCATGGAGACGCTGGTCCTCAAG
TCGATGCACAGAGCCAAGTACTTCATTGCGGGCAAGACGACGAAGGCGCTCTGGCCGCACTACTCCCTGAACCTG
CCCCTGTACACGCACTTCACATCGCCCACCCGTCGCTACGCGGACATTGTGGTGCACCGGCAGCTGGAGGCGGTG
CTGTCGGAGGGCAAGATTGAGTTTACGGACGACATGGAGAATCTTGTCAAGACGGCTGAGGCGTGCAACACCAAG
AAGGACTCGGCACAGAACGCGCAGGAGCAGAGCATCCACATCGAATCCTGCCGCACCATGGACAAGAAGCGGCAG
GAGGCCAACGGGGAGCTGATCGCGGAAGGAATCGTGCTGTGCGTGTACGAGTCGGCCTTTGACGTGCTCATTCCC
GAGTGGGGCTTCGAGAAGCGGGTGCACTGCGATCAGCTGCCGCTCAAGAAGGCCGAGTTCAGGAAAGAGAAGAGG
GTGCTCGAACTGTACTGGGAGAAGGGCGTGCCCAGCTCGGCCTTCGTGCCGGAGGACGAACGGCCCAAGGCGGCG
GCGTCGCAGAGAATGACCAACGCGATGGCGGCGGCGAAGCAGGCGGAGGAGGCGGAGCGGGTCAAGCGGGAGCGG
GAGGAGGCGGCGCGCAAGCAGACGGAGACGGGAACCATGTCGACGGACGACGTGGACGCCCTGTTCGACGACGAC
GACGACGACAACACGTCGGACGTGACGGAGGCCATGGCCGGCGTGTCGCTGGCGGAGCGGCCGACGCAGAGCGTC
CCCGGGTCCCCGGCACGCACGTCATCGAATGCCGGCACGCTGCACCGGACGCGCTCCGACTCCAAGGTGCCCGTC
TCGGAAGCGGTCGAGGCGGGCCTGACGAACAAGGAAAAGTACCTGAAGCTGTTTGAGCTTCGCGAGGAAGGCGGG
GATTACATCCAGGACGTGACGGAGATGAGGAAGTTGCCGATCATCCTGAAGACGGATCTCAGCAAGAGCCCACCC
TGCTTGACGATCCGGTGCTTGAACCCGTATGCGCTATGA
Gene >Hirsu2|10234
ATGGAGCAGCAGCAGCCGCCCCAGCAGCCGGCGCAACAGCAGCAGCAGCCGAAGCCGCAGCAGCAGCCGCCGGCC
GGTGGTGTCCCTGGGCCTACCGGACGACGGCTGCACATTGCCCACCGACGCAGCCCGTCAGAGCTAACACCGTTG
ATGAGCATGTTTGCCAACCCAGGAAGTGAGTCCTCCCATCCCGTCTCTCGTCATGGCAGCCCCCCTCTCCTCGAC
TTCTTCGTTGTCGCCGTCGTCGCCGTCGTCGTCGTCGTCCGCGGGCTCCGTCGGCAGCCTGAAAAGTTTCTGCTT
CCCGACATTTCCCTCCCTCCCTTCCCCCCTTCGCGCCCATACTTGCCGTCGACTAACACGATTTCTTGCCCTCCG
TAGTGGAACAGTTGGCCATCCAGCAACAGATTGAGCTCTTGCAGCAGCAACAGCAGCAAATCCAGGCGACTCACC
AACAATATGTCAACCTGGGCATGATGCCACCCGGCCAGCCCATTGCCCACAACGGAGCGTTCAATCCTTTGCAGC
CCATGGCCAACATGTCCCAAACGGCCTTCCAATTCCCCAACCAGATGCCGCAACAAAATATGTCGATGGGTCCTC
CTACCCAGCCATTGTCACATCGCCGTAATCAGTCGGCACTGCCAAACATGGGTATGGGCCCGCCTCCGGCGCCCT
CGTCTGGAGCCTCTGGTTCCAGCTTTGGTAACTTCGAAGCTCCAGGCGCCCATGGGCGAGAGAACACCGGCGGGC
GAGGCGGGCGAGGCGGCGGCGGCGGCTCCGGCCACCAGCGAAGGCACTCCTTGGCCCTGGCCGACGCCAAGAAAG
CCGCCGAGCTTGCCCAGCAGAAACGAACGACGACGGGCTTTCAGTTCCCCGGCCCCAATGCCTCCGCCGACAAGC
CCGACGACGAGAACACCAAGGGGTCGTCTCAGTCGACGCTCGATGCCTCCGTCGCTCAGGGCTCGACTCGTGGCC
GCGGAGGTCACGGCCGCAGCCAGAGCATGGCCTCCAACGGACGCGGCGGTCGCATGGGCGGCGACGGCGGCGGCG
ATTTCCAGCGCCGCGGCGGCGGCATGGGCCACGCCCGCACCGGATCTCGAAACTACGAGGGTAACTGGCGCACCC
AGAACCAGAACCAAGACCAGTCGGGCGGCGCCGGCCAGTCCCAGCCGTTTCAGCCGGGCCACCGGTCCCGAGGTT
CCATGAACCAGTCCGTCTCCTCGATCGGGGCTTTCCAGTACAACCCCAACCAACCCCAGCTCATGCAGGTCCCGG
GCCAGATGATGATGCCCTCGATGTACGGCCAGCAGCTCAACCCCATGCAGCTCGGCCAGCTACAAGCCCTGCAGG
CGGCACAGATGAACGGCCAGCAGTTTTCGGGTCTCGCGAGCTCCCAGCACGCGGGCTCCGGCGGCGGGCAGCAGC
AGCAGCAGCAGCAGCGCAAGACGCTCTTCACCCCCTACCTCCCCCAGGCTTCGCTGCCCGCCCTTCTCGGAGACG
GCCAGCTCGTCTCCGGCATCCTGCGCGTGAACAAGAAGAACCGAAGTGACGCCTACGTCACGACGCAAGACGGCC
TCCTGGATGCCGACATCTTCATCTGCGGCAGCAAGGATCGCAACCGCGCCCTTGAGGGCGACCTTGTCGCCGTAG
AGCTGCTGGACGTCGATGAAGTTTGGTCCCAGAAGAGGGAGAAGGAGGAGAAGAAGAAGCGTAAAGACATCACTG
ACACGCGTTCTGGCTCCACGAACCAATCCAGCCAGAATTCCGGCCAAAATGACGACGGCAACGCCCCCGAGGGTG
GCATCCGCCGCCGCGGCAGCCTGCGCCAGCGGCCGACCCAGAAGAAGAACGACGATGTCGAGGTGGAGGGCCAGA
GTCTACTTCTCGTCGAGGAAGAAGAGATCAGCGATGAGCAGAAGCCGCTTTATGCCGGCCACATTGTCGCCGTCA
TCGAGCGCGTTGCCGGCCAGATGTTCTCCGGCACGCTCGGCCTCTTGCGCCCCAGCAGTCAGGCGACCAAGGAGA
AGCAAGAGGCCGAGAGGGCCGCCCGCGACGGCGGCAACAGCCGTCACAACGACTCCCGCCAGCAGGAGAAGCCCA
AGATTGTCTGGTTTAAGCCCACGGACAAGCGCGTCCCTCTGATTGCCATTCCCACGGAGCAGGCCCCCCGCGATT
TCGTTGAGAAGCACCAAGACTATGCCGACCGGATCTTTGTCGCCTGCATCAAGCGATGGCCAATCACGTCCCTGC
ACCCCTTCGGCACTCTGGTGGAGCAGCTCGGACGCATGGGCGACCTCAAGGTGGAGACCGATGCCCTGCTCCGAG
ACAACAATTTCTCCTCGGACGAGTTCTCCGACGCCGTCCTGCGCAACGTCGGCCTCCAGGACTGGTCGTTGGCCA
AGGAGGACGAAGAGGCCGTCGCCTCCCGTCGCGACTTCCGCCAGGAGACCGTCTTCACGATCGACTTCAACGGAG
GCTCGGAGCTCGGCAACGGAATCCACGTCAAGACTCGCCCCGACGGCAAGATCGAGATTGGAGTCCACGTGCCCG
ACGTCGCGCACTTCGTGAAGCCCAACTCTCTGGTAGACCGCGAGGCCAAGAAGCGCGGCACCTCGGTCCAGCTGC
TCAACCGGTTCTGTGCACTGCTGCCCCCGAAGCTGTCCGGCGAGGTTTGCTCCCTCGGCCAGGACGAGGAGCGGC
TGGCGGTCAGCGTCGTGTTCAACGTGAATCCCCACAGCGGCTCCGTCGCCGAGGGCGACAGCTGGGTGGGCCGAA
GCGTCGTCAAGAGCAGCGGCAAGGTGTCGTTGGCCGACATGGACAACGCTCTCAAGGACGCCTCGACATTCGCCA
ACGGGACCGTGTCGGTGAACACGATTCAGATCCTCCAGGGGGTGTCGCAGAAATTCCGGGAGGGCCGCTTGGGCG
CGGGGGGCGAGCCGATTGCACCGCTGCGGCTCTTCCAGCAGCTGGACGACGAGAACAATCCGGTGGAGGATAACA
TCTTCAACTCGAGCCCGGCGCTGGAGATGATTGAGGAGCTCATGCACAGGGCCAACGCGCACGTGGCGCAGCGTC
TGGCGGCGGGTCTGCCGGAGAAGGCGCTCCTCCGCCGCCAGGCCGCGCCCAACCCGCGGCGCCTCCAGACTTTCG
TCGAGCGCATGACGGCGCTGGGCTACGAAATCGACGCATCCAGCAGCGGAGCCCTGCAGAACAGTCTGTTCAAGG
TGGACGACACGGATCTTCGCAAGGGCATGGAGACGCTGGTCCTCAAGTCGATGCACAGAGCCAAGTACTTCATTG
CGGGCAAGACGACGAAGGCGCTCTGGCCGCACTACTCCCTGAACCTGCCCCTGTACACGCACTTCACATCGCCCA
CCCGTCGCTACGCGGACATTGTGGTGCACCGGCAGCTGGAGGCGGTGCTGTCGGAGGGCAAGATTGAGTTTACGG
ACGACATGGAGAATCTTGTCAAGACGGCTGAGGCGTGCAACACCAAGAAGGACTCGGCACAGAACGCGCAGGAGC
AGAGCATCCACATCGAATCCTGCCGCACCATGGACAAGAAGCGGCAGGAGGCCAACGGGGAGCTGATCGCGGAAG
GAATCGTGCTGTGCGTGTACGAGTCGGCCTTTGACGTGCTCATTCCCGAGTGGGGCTTCGAGAAGCGGGTGCACT
GCGATCAGCTGCCGCTCAAGAAGGCCGAGTTCAGGAAAGAGAAGAGGGTGCTCGAACTGTACTGGGAGAAGGGCG
TGCCCAGCTCGGCCTTCGTGCCGGAGGACGAACGGCCCAAGGCGGCGGCGTCGCAGAGAATGACCAACGCGATGG
CGGCGGCGAAGCAGGCGGAGGAGGCGGAGCGGGTCAAGCGGGAGCGGGAGGAGGCGGCGCGCAAGCAGACGGAGA
CGGGAACCATGTCGACGGACGACGTGGACGCCCTGTTCGACGACGACGACGACGACAACACGTCGGACGTGACGG
AGGCCATGGCCGGCGTGTCGCTGGCGGAGCGGCCGACGCAGAGCGTCCCCGGGTCCCCGGCACGCACGTCATCGA
ATGCCGGCACGCTGCACCGGACGCGCTCCGACTCCAAGGTGCCCGTCTCGGAAGCGGTCGAGGCGGGCCTGACGA
ACAAGGAAAAGTACCTGAAGCTGTTTGAGCTTCGCGAGGAAGGCGGGGATTACATCCAGGACGTGACGGAGATGA
GGAAGTTGCCGATCATCCTGAAGACGGATCTCAGCAAGAGCCCACCGTAAGTGTTCCGTCGATGGGATAGGAGAG
AATGGCGAGGTTGCGAGAGCTAACGACGAGTGACAACAGCTGCTTGACGATCCGGTGCTTGAACCCGTATGCGCT
ATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail