Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10223
Gene name
LocationContig_805:82..2549
Strand-
Gene length (bp)2467
Transcript length (bp)2037
Coding sequence length (bp)2037
Protein length (aa) 679

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04082 Fungal_trans Fungal specific transcription factor domain 9.7E-24 307 551
PF00172 Zn_clus Fungal Zn(2)-Cys(6) binuclear cluster domain 1.5E-10 65 104

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O59741|YN25_SCHPO Uncharacterized transcriptional regulatory protein C530.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.05 PE=3 SV=2 56 638 3.0E-43
sp|Q10086|YAO7_SCHPO Uncharacterized transcriptional regulatory protein C11D3.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.07c PE=3 SV=3 65 669 5.0E-30
sp|P87000|ACU15_NEUCR Transcriptional activator protein acu-15 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=acu-15 PE=1 SV=2 58 594 1.0E-29
sp|O14130|YF54_SCHPO Uncharacterized transcriptional regulatory protein C3C7.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3C7.04 PE=3 SV=1 66 673 3.0E-26
sp|Q9C0Z1|YKM1_SCHPO Uncharacterized transcriptional regulatory protein PB24D3.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB24D3.01 PE=3 SV=2 285 668 2.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O59741|YN25_SCHPO Uncharacterized transcriptional regulatory protein C530.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.05 PE=3 SV=2 56 638 3.0E-43
sp|Q10086|YAO7_SCHPO Uncharacterized transcriptional regulatory protein C11D3.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.07c PE=3 SV=3 65 669 5.0E-30
sp|P87000|ACU15_NEUCR Transcriptional activator protein acu-15 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=acu-15 PE=1 SV=2 58 594 1.0E-29
sp|O14130|YF54_SCHPO Uncharacterized transcriptional regulatory protein C3C7.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3C7.04 PE=3 SV=1 66 673 3.0E-26
sp|Q9C0Z1|YKM1_SCHPO Uncharacterized transcriptional regulatory protein PB24D3.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB24D3.01 PE=3 SV=2 285 668 2.0E-20
sp|P40467|ASG1_YEAST Activator of stress genes 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ASG1 PE=1 SV=1 297 661 2.0E-17
sp|P39529|YJU6_YEAST Putative transcriptional regulatory protein YJL206C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YJL206C PE=2 SV=1 296 555 6.0E-17
sp|P36598|THI1_SCHPO Thiamine repressible genes regulatory protein thi1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=thi1 PE=1 SV=2 59 469 2.0E-16
sp|P49413|UAY_EMENI Positive regulator of purine utilization OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=uaY PE=3 SV=2 62 483 9.0E-16
sp|O94573|YGDG_SCHPO Uncharacterized transcriptional regulatory protein C1773.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.16c PE=3 SV=1 291 666 2.0E-15
sp|O94569|YGDC_SCHPO Uncharacterized transcriptional regulatory protein C1773.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.12 PE=3 SV=1 293 669 7.0E-13
sp|Q59LV8|ASG1_CANAL Activator of stress genes protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ASG1 PE=3 SV=1 291 595 1.0E-12
sp|O94490|YC79_SCHPO Uncharacterized transcriptional regulatory protein C417.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC417.09c PE=3 SV=1 252 671 1.0E-11
sp|O59744|YN28_SCHPO Uncharacterized transcriptional regulatory protein C530.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.08 PE=3 SV=1 332 663 2.0E-10
sp|O60130|YH7G_SCHPO Putative transcriptional regulatory protein C16G5.16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16G5.16 PE=1 SV=1 52 136 1.0E-09
sp|P38699|STB5_YEAST Protein STB5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STB5 PE=1 SV=1 310 553 1.0E-09
sp|Q59LV8|ASG1_CANAL Activator of stress genes protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ASG1 PE=3 SV=1 55 98 5.0E-09
sp|Q12180|HAL9_YEAST Halotolerance protein 9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HAL9 PE=1 SV=1 244 559 5.0E-09
sp|P08657|LAC9_KLULA Lactose regulatory protein LAC9 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=LAC9 PE=1 SV=1 65 127 6.0E-09
sp|Q4WK35|AMDR_ASPFU Acetamidase regulatory protein OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=amdR PE=3 SV=1 299 669 7.0E-09
sp|P40467|ASG1_YEAST Activator of stress genes 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ASG1 PE=1 SV=1 58 102 9.0E-09
sp|P10563|QUTA_EMENI Quinic acid utilization activator OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=qutA PE=3 SV=2 59 116 1.0E-08
sp|P39113|CAT8_YEAST Regulatory protein CAT8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAT8 PE=1 SV=2 62 123 2.0E-08
sp|P11638|QA1F_NEUCR Quinic acid utilization activator OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=qa-1f PE=3 SV=2 58 122 6.0E-08
sp|Q6FLP2|RGT1_CANGA Glucose transport transcription regulator RGT1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RGT1 PE=3 SV=1 52 109 1.0E-07
sp|P07272|PPR1_YEAST Pyrimidine pathway regulatory protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPR1 PE=1 SV=1 66 327 1.0E-07
sp|O93870|FCR1_CANAX Fluconazole resistance protein 1 OS=Candida albicans GN=FCR1 PE=3 SV=1 59 129 4.0E-07
sp|Q4WZV6|XLNR_ASPFU Xylanolytic transcriptional activator xlnR OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=xlnR PE=3 SV=1 60 103 4.0E-07
sp|Q09922|YAKB_SCHPO Uncharacterized transcriptional regulatory protein C1F7.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F7.11c PE=3 SV=1 58 526 5.0E-07
sp|Q0CV52|XLNR_ASPTN Xylanolytic transcriptional activator xlnR OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=xlnR PE=3 SV=2 60 103 5.0E-07
sp|Q96WP8|XLNR_ASPKA Xylanolytic transcriptional activator xlnR OS=Aspergillus kawachii GN=xlnR PE=3 SV=2 55 103 5.0E-07
sp|A2R5W7|XLNR_ASPNC Xylanolytic transcriptional activator xlnR OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=xlnR PE=3 SV=2 55 103 6.0E-07
sp|Q2UD93|XLNR_ASPOR Xylanolytic transcriptional activator xlnR OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=xlnR PE=1 SV=2 60 103 6.0E-07
sp|B8N6M6|XLNR_ASPFN Xylanolytic transcriptional activator xlnR OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=xlnR PE=3 SV=1 60 103 6.0E-07
sp|Q5AVS0|XLNR_EMENI Xylanolytic transcriptional activator xlnR OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=xlnR PE=2 SV=2 46 103 6.0E-07
sp|O42804|XLNR_ASPNG Xylanolytic transcriptional activator xlnR OS=Aspergillus niger GN=xlnR PE=1 SV=2 55 103 6.0E-07
sp|A1DIC0|XLNR_NEOFI Xylanolytic transcriptional activator xlnR OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=xlnR PE=3 SV=2 60 103 7.0E-07
sp|O59780|YCN3_SCHPO Uncharacterized transcriptional regulatory protein C320.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC320.03 PE=3 SV=1 60 108 7.0E-07
sp|B0XUL1|XLNR_ASPFC Xylanolytic transcriptional activator xlnR OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=xlnR PE=3 SV=1 60 103 7.0E-07
sp|P04386|GAL4_YEAST Regulatory protein GAL4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAL4 PE=1 SV=2 259 469 1.0E-06
sp|O74541|YCV2_SCHPO Uncharacterized transcriptional regulatory protein C777.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC777.02 PE=3 SV=4 372 555 1.0E-06
sp|O59744|YN28_SCHPO Uncharacterized transcriptional regulatory protein C530.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.08 PE=3 SV=1 67 127 2.0E-06
sp|Q05958|ECM22_YEAST Sterol regulatory element-binding protein ECM22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECM22 PE=1 SV=1 66 121 2.0E-06
sp|Q1MTM9|YFN1_SCHPO Uncharacterized transcriptional regulatory protein C1327.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1327.01c PE=1 SV=2 60 104 3.0E-06
sp|Q750N3|RGT1_ASHGO Glucose transport transcription regulator RGT1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RGT1 PE=3 SV=1 52 114 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005634 nucleus Yes
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific Yes
GO:0008270 zinc ion binding Yes
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0006351 transcription, DNA-templated Yes
GO:0003677 DNA binding Yes
GO:0031326 regulation of cellular biosynthetic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0043227 membrane-bounded organelle No
GO:0009987 cellular process No
GO:1901363 heterocyclic compound binding No
GO:2001141 regulation of RNA biosynthetic process No
GO:0043167 ion binding No
GO:0018130 heterocycle biosynthetic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0044424 intracellular part No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0009059 macromolecule biosynthetic process No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0090304 nucleic acid metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0050789 regulation of biological process No
GO:0009058 biosynthetic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0044464 cell part No
GO:1901576 organic substance biosynthetic process No
GO:0043231 intracellular membrane-bounded organelle No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0080090 regulation of primary metabolic process No
GO:2000112 regulation of cellular macromolecule biosynthetic process No
GO:0140110 transcription regulator activity No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0003700 DNA-binding transcription factor activity No
GO:1901360 organic cyclic compound metabolic process No
GO:0046914 transition metal ion binding No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0043229 intracellular organelle No
GO:0097659 nucleic acid-templated transcription No
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0031323 regulation of cellular metabolic process No
GO:0065007 biological regulation No
GO:0097159 organic cyclic compound binding No
GO:0016070 RNA metabolic process No
GO:0010468 regulation of gene expression No
GO:0003676 nucleic acid binding No
GO:0032774 RNA biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0019222 regulation of metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0005488 binding No
GO:0044238 primary metabolic process No
GO:0050794 regulation of cellular process No
GO:0046872 metal ion binding No
GO:0008152 metabolic process No
GO:0043169 cation binding No
GO:0008150 biological_process No
GO:0051252 regulation of RNA metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0009889 regulation of biosynthetic process No
GO:0043226 organelle No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0060255 regulation of macromolecule metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

Domain # Start End Length
1 646 668 22

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Fungal Specific TF

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10223
MDHMGFQIPGMAPPPLMNQPPQIFGAYGPEALPHMAPDFASHMFPDSHHLLMEDSNEAKRRRIARACDMCRKKKI
KCDGKLPACTHCINYKTDCVFTQVEKKRSPPKGAKYIEGLENRLGRMEHLLKLSGLLSEDDNGATDLGELEKKLT
EKTRQASMVTISSATSPSQGTSGQDGTNSTPHSALTSPEPGKETHRVDEKRKSIMSTDESQGEEEVEALSEMMCS
LVTNQCGETRYIGSSSGFSIFSPRGISWVNEKTGDESFAKMISEVSVDDHKWTNWKPEVFGDLFQRRVFRPLPPK
PEALSLLKDYFENFNCMFPLFHQPTFMHLVERQYSSDPYQGSGWWASLNCALAVAHRLRVMSNLVPQEEDEKAWA
YLKNAMAVFPELTMRNTDLLSVQALLGMALFMQGTPNPQPTSLLIAAAIRLAHSIGLHKRGTGFNLNPIEIEQRK
RVFWIAYMLDKDLCLRSGRPAAQDDDDMNVDLPDADPPDNIGNIPLADGKGKMNLFRVICEFTVIESNVYKRLYS
TKATKQSDGELLNTIGELDQELEEWKDRIPIDFRPEHEIKASHTPLILHIVMLHFTYYNCLTTIHRMSIHHGYWT
SRLSNYAIQGLNARPLNPRVFSSAALCTAAARASISLLKYIPQGDFSCVWLILYFPVSALMTLFGNILQNPLDPR
AKW*
Coding >Hirsu2|10223
ATGGACCACATGGGCTTCCAAATACCGGGCATGGCCCCGCCGCCCTTGATGAACCAGCCGCCTCAGATCTTCGGT
GCCTACGGCCCCGAGGCCCTGCCGCACATGGCCCCCGACTTTGCTTCGCACATGTTCCCCGACTCCCACCACCTG
CTCATGGAGGATTCCAACGAGGCGAAGCGCAGGAGGATCGCAAGGGCCTGTGACATGTGCCGCAAAAAGAAGATC
AAGTGCGACGGCAAACTGCCCGCTTGTACGCACTGCATCAACTACAAGACCGACTGCGTCTTCACCCAGGTCGAG
AAGAAGCGCAGTCCGCCCAAGGGGGCCAAGTACATCGAGGGCCTGGAGAACCGCCTGGGCCGCATGGAGCACCTG
TTGAAGCTGTCGGGCCTGCTGAGCGAGGACGACAATGGCGCCACCGACCTCGGCGAGCTCGAGAAGAAGCTCACC
GAGAAGACGCGCCAGGCGTCCATGGTCACCATCTCCAGTGCCACCTCGCCCTCCCAGGGCACCTCGGGCCAGGAC
GGCACCAACTCGACGCCCCACAGCGCCTTGACGTCGCCCGAGCCCGGCAAGGAGACGCACCGCGTCGACGAGAAG
CGCAAGTCCATCATGTCGACCGACGAGAGCCAGGGAGAGGAGGAGGTCGAGGCCCTGTCCGAGATGATGTGCTCC
CTCGTCACCAACCAATGCGGGGAGACGCGATATATCGGCTCCTCGTCCGGCTTCTCCATCTTCTCCCCGAGAGGC
ATCTCGTGGGTCAACGAGAAGACGGGAGACGAGTCCTTCGCCAAAATGATCTCCGAGGTCTCCGTCGACGACCAC
AAGTGGACCAACTGGAAGCCCGAGGTCTTCGGCGACCTGTTCCAGCGCCGCGTCTTCCGCCCCCTGCCGCCCAAG
CCCGAGGCCCTGTCGCTGCTCAAGGACTACTTCGAAAACTTCAACTGCATGTTCCCCCTCTTCCACCAGCCCACC
TTCATGCACCTGGTCGAGCGCCAGTACTCGTCGGACCCCTACCAGGGCTCCGGCTGGTGGGCCAGCCTCAACTGC
GCCCTGGCCGTCGCCCACCGCCTGCGCGTCATGAGCAACCTGGTGCCGCAGGAGGAGGACGAGAAGGCCTGGGCC
TACCTCAAGAACGCCATGGCCGTCTTCCCCGAGCTGACGATGCGCAACACGGACCTGCTGAGCGTCCAGGCCCTG
CTCGGCATGGCCCTCTTCATGCAGGGCACGCCCAACCCGCAGCCGACGTCGCTCCTCATCGCCGCCGCCATCCGC
CTGGCCCACAGCATCGGCCTGCACAAGCGCGGCACCGGCTTCAACCTGAACCCCATCGAGATCGAGCAGCGCAAG
CGCGTCTTCTGGATCGCCTACATGCTCGACAAGGACCTCTGCCTGCGCTCCGGCCGCCCGGCCGCCCAGGACGAC
GACGACATGAACGTCGACCTGCCCGACGCCGACCCGCCCGACAACATCGGCAACATACCGCTCGCCGACGGCAAG
GGCAAGATGAACCTGTTCCGCGTCATCTGCGAGTTCACCGTCATCGAGAGCAACGTCTACAAGCGCCTGTACTCG
ACCAAGGCCACCAAGCAGTCGGACGGCGAGCTGCTCAACACCATCGGCGAGCTGGACCAGGAGCTCGAGGAGTGG
AAGGACAGGATCCCCATCGACTTCCGCCCCGAGCACGAGATCAAGGCCTCGCACACGCCCCTGATCCTGCACATC
GTCATGCTGCACTTCACCTACTACAACTGCCTGACCACCATCCACCGCATGTCCATCCACCACGGCTACTGGACG
AGCAGGCTGTCCAACTACGCCATCCAGGGCCTCAACGCCCGGCCCCTCAACCCGAGGGTCTTCTCCTCGGCCGCC
CTGTGCACCGCGGCCGCGAGGGCGTCCATTTCGCTGTTGAAGTACATCCCCCAGGGGGACTTTAGCTGCGTCTGG
CTGATTCTGTACTTCCCCGTCTCGGCCCTGATGACGCTGTTCGGAAACATCCTGCAGAACCCGCTGGACCCGCGC
GCCAAGTGGTGA
Transcript >Hirsu2|10223
ATGGACCACATGGGCTTCCAAATACCGGGCATGGCCCCGCCGCCCTTGATGAACCAGCCGCCTCAGATCTTCGGT
GCCTACGGCCCCGAGGCCCTGCCGCACATGGCCCCCGACTTTGCTTCGCACATGTTCCCCGACTCCCACCACCTG
CTCATGGAGGATTCCAACGAGGCGAAGCGCAGGAGGATCGCAAGGGCCTGTGACATGTGCCGCAAAAAGAAGATC
AAGTGCGACGGCAAACTGCCCGCTTGTACGCACTGCATCAACTACAAGACCGACTGCGTCTTCACCCAGGTCGAG
AAGAAGCGCAGTCCGCCCAAGGGGGCCAAGTACATCGAGGGCCTGGAGAACCGCCTGGGCCGCATGGAGCACCTG
TTGAAGCTGTCGGGCCTGCTGAGCGAGGACGACAATGGCGCCACCGACCTCGGCGAGCTCGAGAAGAAGCTCACC
GAGAAGACGCGCCAGGCGTCCATGGTCACCATCTCCAGTGCCACCTCGCCCTCCCAGGGCACCTCGGGCCAGGAC
GGCACCAACTCGACGCCCCACAGCGCCTTGACGTCGCCCGAGCCCGGCAAGGAGACGCACCGCGTCGACGAGAAG
CGCAAGTCCATCATGTCGACCGACGAGAGCCAGGGAGAGGAGGAGGTCGAGGCCCTGTCCGAGATGATGTGCTCC
CTCGTCACCAACCAATGCGGGGAGACGCGATATATCGGCTCCTCGTCCGGCTTCTCCATCTTCTCCCCGAGAGGC
ATCTCGTGGGTCAACGAGAAGACGGGAGACGAGTCCTTCGCCAAAATGATCTCCGAGGTCTCCGTCGACGACCAC
AAGTGGACCAACTGGAAGCCCGAGGTCTTCGGCGACCTGTTCCAGCGCCGCGTCTTCCGCCCCCTGCCGCCCAAG
CCCGAGGCCCTGTCGCTGCTCAAGGACTACTTCGAAAACTTCAACTGCATGTTCCCCCTCTTCCACCAGCCCACC
TTCATGCACCTGGTCGAGCGCCAGTACTCGTCGGACCCCTACCAGGGCTCCGGCTGGTGGGCCAGCCTCAACTGC
GCCCTGGCCGTCGCCCACCGCCTGCGCGTCATGAGCAACCTGGTGCCGCAGGAGGAGGACGAGAAGGCCTGGGCC
TACCTCAAGAACGCCATGGCCGTCTTCCCCGAGCTGACGATGCGCAACACGGACCTGCTGAGCGTCCAGGCCCTG
CTCGGCATGGCCCTCTTCATGCAGGGCACGCCCAACCCGCAGCCGACGTCGCTCCTCATCGCCGCCGCCATCCGC
CTGGCCCACAGCATCGGCCTGCACAAGCGCGGCACCGGCTTCAACCTGAACCCCATCGAGATCGAGCAGCGCAAG
CGCGTCTTCTGGATCGCCTACATGCTCGACAAGGACCTCTGCCTGCGCTCCGGCCGCCCGGCCGCCCAGGACGAC
GACGACATGAACGTCGACCTGCCCGACGCCGACCCGCCCGACAACATCGGCAACATACCGCTCGCCGACGGCAAG
GGCAAGATGAACCTGTTCCGCGTCATCTGCGAGTTCACCGTCATCGAGAGCAACGTCTACAAGCGCCTGTACTCG
ACCAAGGCCACCAAGCAGTCGGACGGCGAGCTGCTCAACACCATCGGCGAGCTGGACCAGGAGCTCGAGGAGTGG
AAGGACAGGATCCCCATCGACTTCCGCCCCGAGCACGAGATCAAGGCCTCGCACACGCCCCTGATCCTGCACATC
GTCATGCTGCACTTCACCTACTACAACTGCCTGACCACCATCCACCGCATGTCCATCCACCACGGCTACTGGACG
AGCAGGCTGTCCAACTACGCCATCCAGGGCCTCAACGCCCGGCCCCTCAACCCGAGGGTCTTCTCCTCGGCCGCC
CTGTGCACCGCGGCCGCGAGGGCGTCCATTTCGCTGTTGAAGTACATCCCCCAGGGGGACTTTAGCTGCGTCTGG
CTGATTCTGTACTTCCCCGTCTCGGCCCTGATGACGCTGTTCGGAAACATCCTGCAGAACCCGCTGGACCCGCGC
GCCAAGTGGTGA
Gene >Hirsu2|10223
ATGGACCACATGGGCTTCCAAATACCGGGCATGGCCCCGCCGCCCTTGATGAACCAGCCGCCTCAGATCTTCGGT
GCCTACGGCCCCGAGGCCCTGCCGCACATGGCCCCCGACTTTGCTTCGCACATGTTCCCCGACTCCCACCACCTG
CTCATGGAGGATTCCAACGAGGCGAAGCGCAGGAGGATCGCAAGGGCAAGTCGCTCCCCGTCCGCCGTCAAGCCC
CGTCGACCGTCCCCGTCCTCCTCGCTCTGCCCGCTGACCTCGACTCGCCCTCTGTCTCTCTCCAGGCCTGTGACA
TGTGCCGCAAAAAGAAGATCAAGTGCGACGGCAAACTGCCCGCTTGTACGCACTGCATCAACTACAAGACCGACT
GCGTCTTCACCCAGGTCGAGAAGAAGCGCAGTCCGCCCAAGGGGTATCTACCGCCTCCCCCTTCTGCGGCCAGCC
TCGTCCCCGTGCCCGAGGGGCGCCCAGACTCGGCTGACAATTTCACGCAGGGCCAAGTACATCGAGGGCCTGGAG
AACCGCCTGGGCCGCATGGAGCACCTGTTGAAGCTGTCGGGCCTGCTGAGCGAGGACGACAATGGCGCCACCGAC
CTCGGCGAGCTCGAGAAGAAGCTCACCGAGAAGACGCGCCAGGCGTCCATGGTCACCATCTCCAGTGCCACCTCG
CCCTCCCAGGGCACCTCGGGCCAGGACGGCACCAACTCGACGCCCCACAGCGCCTTGACGTCGCCCGAGCCCGGC
AAGGAGACGCACCGCGTCGACGAGAAGCGCAAGTCCATCATGTCGACCGACGAGAGCCAGGGAGAGGAGGAGGTC
GAGGCCCTGTCCGAGATGATGTGCTCCCTCGTCACCAACCAATGCGGGGAGACGCGATATATCGGTAATACGGCC
CCTGCCCGCCCGCCCGCCCCCCTTTTGCCCGCGCTGACTGACGGCGCCGCCAGGCTCCTCGTCCGGCTTCTCCAT
CTTCTCCCCGAGAGGCATCTCGTGGGTCAACGAGAAGACGGGAGACGAGTCCTTCGCCAAAATGATCTCCGAGGT
CTCCGTCGACGACCACAAGTGGACCAACTGGAAGCCCGAGGTCTTCGGCGACCTGTTCCAGCGCCGCGTCTTCCG
CCCCCTGCCGCCCAAGCCCGAGGCCCTGTCGCTGCTCAAGGACTACTTCGAAAACTTCAACTGCATGTTCCCCCT
CTTCCACCAGCCCACCTTCATGCACCTGGTCGAGCGCCAGTACTCGTCGGACCCCTACCAGGGCTCCGGCTGGTG
GGCCAGCCTCAACTGCGCCCTGGCCGTCGCCCACCGCCTGCGCGTCATGAGCAACCTGGTGCCGCAGGAGGAGGA
CGAGAAGGCCTGGGCCTACCTCAAGAACGCCATGGCCGTCTTCCCCGAGCTGACGATGCGCAACACGGACCTGCT
GAGCGTCCAGGCCCTGCTCGGCATGGCCCTCTTCATGCAGGGCACGCCCAACCCGCAGCCGACGTCGCTCCTCAT
CGCCGCCGCCATCCGCCTGGCCCACAGCATCGGCCTGCACAAGCGCGGCACCGGCTTCAACCTGAACCCCATCGA
GATCGAGCAGCGCAAGCGCGTCTTCTGGATCGCCTACATGCTCGACAAGGACCTCTGCCTGCGCTCCGGCCGCCC
GGCCGCCCAGGACGACGACGACATGAACGTCGACCTGCCCGACGCCGACCCGCCCGACAACATCGGCAACATACC
GCTCGCCGACGGCAAGGGCAAGATGAACCTGTTCCGCGTCATCTGCGAGTTCACCGTCATCGAGAGCAACGTCTA
CAAGCGCCTGTACTCGACCAAGGCCACCAAGCAGTCGGACGGCGAGCTGCTCAACACCATCGGCGAGCTGGACCA
GGAGCTCGAGGAGTGGAAGGACAGGATCCCCATCGACTTCCGCCCCGAGCACGAGATCAAGGCCTCGCACACGCC
CCTGATCCTGCACATCGTCATGCTGCACTTCACCTACTACAACTGCCTGACCACCATCCACCGCATGTCCATCCA
CCACGGCTACTGGACGAGCAGGCTGTCCAACTACGCCATCCAGGGCCTCAACGCCCGGCCCCTCAACCCGAGGGT
CTTCTCCTCGGCCGCCCTGTGCACCGCGGCCGCGAGGGCGTCCATTTCGCTGTTGAAGTACATCCCCCAGGGGGA
CTTTAGCTGCGTCTGGTGAGTCTTTCCCGTCGCCGGATCCCGCGCCGCCTCGGCCGACCAACGCTGACTGACACC
CGCGACAGGCTGATTCTGTACTTCCCCGTCTCGGCCCTGATGACGCTGTTCGGAAACATCCTGCAGAACCCGCTG
GACCCGCGCGCCAAGTCGGACGCCCGGCTGATGAACCTGGTCGTCACCTTCCTCTCCATGCTCGGCCAGGAGGCG
GAGCAGGGCGGGGTGCACCGGATGCTCGGCATCTGCTCCGAGTTCGTGCGCATCGCCAAGGTGGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail