Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10220
Gene name
LocationContig_804:953..1571
Strand+
Gene length (bp)618
Transcript length (bp)618
Coding sequence length (bp)618
Protein length (aa) 206

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.5384 0.7841 0.54 0.1471 0.0553 0.0058 0.1593 0.021 0.0523 0.0013

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup369
Change Orthofinder run
Species Protein ID
Ophiocordyceps kimflemingae Ophio5|941
Ophiocordyceps subramaniannii Hirsu2|10220 (this protein)
Ophiocordyceps subramaniannii Hirsu2|1656
Ophiocordyceps subramaniannii Hirsu2|552
Ophiocordyceps subramaniannii Hirsu2|7707
Ophiocordyceps subramaniannii Hirsu2|7736
Ophiocordyceps subramaniannii Hirsu2|8187
Ophiocordyceps subramaniannii Hirsu2|84
Ophiocordyceps subramaniannii Hirsu2|8425
Ophiocordyceps subramaniannii Hirsu2|8428

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10220
MIWVPAKIDNFVLGPKAKTAAKRATGQQATPERHSYQARSTIARLAVAKHRQNKLPNEVGKYSKRVDNALPGKHT
RALYDTPNRKEANVLVQLRTGMSRLNSSLHKIGAVESDLCDCGQAPETMERFLFRCRKWTSERDILMLCARTRIG
NLSHFLGGKTGHDPKNWTSTRHEGSQGSDQIRTRHRKARQRAETAVEMMMQTSQH*
Coding >Hirsu2|10220
ATGATCTGGGTGCCAGCCAAGATCGATAACTTCGTGCTAGGCCCGAAGGCAAAAACAGCGGCGAAAAGGGCAACA
GGGCAACAGGCTACGCCGGAAAGGCACTCGTACCAGGCCCGGTCGACAATCGCCAGGCTGGCAGTGGCCAAACAT
CGACAGAACAAGCTGCCCAATGAAGTAGGCAAATACTCGAAAAGGGTAGACAACGCCCTACCGGGCAAGCATACG
CGAGCTTTGTATGACACGCCCAACAGGAAAGAAGCCAACGTGCTGGTGCAGCTTCGTACTGGCATGTCGCGACTC
AACAGCTCTCTACACAAGATTGGGGCAGTGGAAAGCGACCTGTGCGACTGCGGCCAGGCACCAGAGACCATGGAA
CGTTTTCTCTTCCGATGCAGAAAATGGACGTCGGAACGCGACATCCTAATGCTGTGCGCAAGAACAAGAATTGGA
AACTTATCGCATTTTCTTGGAGGAAAAACAGGACACGACCCAAAGAACTGGACGTCCACCAGACATGAAGGCAGT
CAGGGCAGCGATCAAATTCGCACTCGCCACAGGAAGGCTCGACAGAGAGCAGAGACAGCAGTCGAGATGATGATG
CAGACCAGTCAACACTAA
Transcript >Hirsu2|10220
ATGATCTGGGTGCCAGCCAAGATCGATAACTTCGTGCTAGGCCCGAAGGCAAAAACAGCGGCGAAAAGGGCAACA
GGGCAACAGGCTACGCCGGAAAGGCACTCGTACCAGGCCCGGTCGACAATCGCCAGGCTGGCAGTGGCCAAACAT
CGACAGAACAAGCTGCCCAATGAAGTAGGCAAATACTCGAAAAGGGTAGACAACGCCCTACCGGGCAAGCATACG
CGAGCTTTGTATGACACGCCCAACAGGAAAGAAGCCAACGTGCTGGTGCAGCTTCGTACTGGCATGTCGCGACTC
AACAGCTCTCTACACAAGATTGGGGCAGTGGAAAGCGACCTGTGCGACTGCGGCCAGGCACCAGAGACCATGGAA
CGTTTTCTCTTCCGATGCAGAAAATGGACGTCGGAACGCGACATCCTAATGCTGTGCGCAAGAACAAGAATTGGA
AACTTATCGCATTTTCTTGGAGGAAAAACAGGACACGACCCAAAGAACTGGACGTCCACCAGACATGAAGGCAGT
CAGGGCAGCGATCAAATTCGCACTCGCCACAGGAAGGCTCGACAGAGAGCAGAGACAGCAGTCGAGATGATGATG
CAGACCAGTCAACACTAA
Gene >Hirsu2|10220
ATGATCTGGGTGCCAGCCAAGATCGATAACTTCGTGCTAGGCCCGAAGGCAAAAACAGCGGCGAAAAGGGCAACA
GGGCAACAGGCTACGCCGGAAAGGCACTCGTACCAGGCCCGGTCGACAATCGCCAGGCTGGCAGTGGCCAAACAT
CGACAGAACAAGCTGCCCAATGAAGTAGGCAAATACTCGAAAAGGGTAGACAACGCCCTACCGGGCAAGCATACG
CGAGCTTTGTATGACACGCCCAACAGGAAAGAAGCCAACGTGCTGGTGCAGCTTCGTACTGGCATGTCGCGACTC
AACAGCTCTCTACACAAGATTGGGGCAGTGGAAAGCGACCTGTGCGACTGCGGCCAGGCACCAGAGACCATGGAA
CGTTTTCTCTTCCGATGCAGAAAATGGACGTCGGAACGCGACATCCTAATGCTGTGCGCAAGAACAAGAATTGGA
AACTTATCGCATTTTCTTGGAGGAAAAACAGGACACGACCCAAAGAACTGGACGTCCACCAGACATGAAGGCAGT
CAGGGCAGCGATCAAATTCGCACTCGCCACAGGAAGGCTCGACAGAGAGCAGAGACAGCAGTCGAGATGATGATG
CAGACCAGTCAACACTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail