Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10218
Gene name
LocationContig_803:10044..11395
Strand+
Gene length (bp)1351
Transcript length (bp)1230
Coding sequence length (bp)1230
Protein length (aa) 410

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07732 Cu-oxidase_3 Multicopper oxidase 5.9E-08 119 229

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9JTB8|ANIA_NEIMA Copper-containing nitrite reductase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=aniA PE=3 SV=1 86 392 2.0E-77
sp|Q9JYE1|ANIA_NEIMB Copper-containing nitrite reductase OS=Neisseria meningitidis serogroup B (strain MC58) GN=aniA PE=3 SV=1 79 392 8.0E-77
sp|Q02219|ANIA_NEIGO Copper-containing nitrite reductase OS=Neisseria gonorrhoeae GN=aniA PE=1 SV=1 86 396 8.0E-77
sp|Q92Z29|NIRK_RHIME Copper-containing nitrite reductase OS=Rhizobium meliloti (strain 1021) GN=nirK PE=3 SV=1 82 400 8.0E-35
sp|Q01537|NIR_RHIGA Copper-containing nitrite reductase OS=Rhizobium galegae GN=nirU PE=3 SV=1 134 392 1.0E-32
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9JTB8|ANIA_NEIMA Copper-containing nitrite reductase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=aniA PE=3 SV=1 86 392 2.0E-77
sp|Q9JYE1|ANIA_NEIMB Copper-containing nitrite reductase OS=Neisseria meningitidis serogroup B (strain MC58) GN=aniA PE=3 SV=1 79 392 8.0E-77
sp|Q02219|ANIA_NEIGO Copper-containing nitrite reductase OS=Neisseria gonorrhoeae GN=aniA PE=1 SV=1 86 396 8.0E-77
sp|Q92Z29|NIRK_RHIME Copper-containing nitrite reductase OS=Rhizobium meliloti (strain 1021) GN=nirK PE=3 SV=1 82 400 8.0E-35
sp|Q01537|NIR_RHIGA Copper-containing nitrite reductase OS=Rhizobium galegae GN=nirU PE=3 SV=1 134 392 1.0E-32
sp|Q60214|NIR_RHISU Copper-containing nitrite reductase OS=Rhizobium sullae GN=nirK PE=3 SV=1 82 400 2.0E-31
sp|Q53239|NIR_RHOS5 Copper-containing nitrite reductase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=nirK PE=1 SV=2 99 392 2.0E-29
sp|P81445|NIR_ALCXX Copper-containing nitrite reductase OS=Alcaligenes xylosoxydans xylosoxydans GN=nirK PE=1 SV=1 134 402 9.0E-28
sp|P25006|NIR_ACHCY Copper-containing nitrite reductase OS=Achromobacter cycloclastes GN=nirK PE=1 SV=2 82 400 1.0E-27
sp|Q06006|NIR_PSECL Copper-containing nitrite reductase OS=Pseudomonas chlororaphis GN=nirK PE=1 SV=1 89 403 2.0E-27
sp|P38501|NIR_ALCFA Copper-containing nitrite reductase OS=Alcaligenes faecalis GN=nirK PE=1 SV=1 135 400 6.0E-27
sp|Q40588|ASO_TOBAC L-ascorbate oxidase OS=Nicotiana tabacum GN=AAO PE=2 SV=1 118 283 8.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005507 copper ion binding Yes
GO:0046872 metal ion binding No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0046914 transition metal ion binding No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.5

Transmembrane Domains

Domain # Start End Length
1 13 35 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10218
MSTQSKTPDHGPRARLVSMAAAFATVAVGIGIYTMRQDPFQAGFAPGSRQAVSEKPLAASIRPAGQPSDASFYEA
LDDEVPDVETLPVEEAQLLSAPNVPPPIRRDHAVLLKVPLTTSTKTAQVTNQYKYEQWTFNGTVPGPFIRARVGD
VVELTLTNRDGTGNPHNIDSHAFTGPGGGAAVTTAEENETKMARFRLLCPGLYVYHCAAAPVPVHIANGMYGLMY
VQPAEGDLPAVDREYYVMQSELYHEPPEVLDDGRPSGTVEFSYPNGLREEPNAVVFNGSESALTRDRPLKAAAGE
TVRIFFGNAGPNLTSSLHLIGSHFRRVYRDGDVVSAPGRFVGTVAVPPGGATVVDLKMVVPGTYTLVDHAIFRLD
KGAVGFLNVSGPPRPDVYGSREPPAPCVGCKLHA*
Coding >Hirsu2|10218
ATGAGCACGCAGTCCAAGACGCCAGACCATGGCCCCCGTGCTAGACTGGTATCCATGGCGGCCGCTTTCGCCACC
GTTGCGGTTGGTATCGGCATATATACCATGCGACAGGACCCATTTCAGGCGGGTTTCGCGCCGGGGAGCCGCCAG
GCCGTTTCCGAGAAGCCGCTTGCCGCCTCCATCCGTCCGGCCGGCCAGCCGTCAGACGCCAGCTTCTACGAGGCT
TTGGATGACGAAGTCCCGGACGTAGAGACGCTTCCAGTCGAGGAGGCGCAGCTTCTGAGCGCCCCCAACGTCCCC
CCACCCATCCGGCGGGACCACGCCGTGCTCCTCAAGGTGCCGCTGACGACGTCGACCAAGACGGCGCAGGTGACG
AACCAGTACAAGTACGAGCAGTGGACCTTCAACGGGACGGTGCCCGGCCCCTTCATCCGGGCGCGCGTGGGCGAC
GTGGTGGAGCTGACGCTCACGAACCGGGACGGCACGGGCAACCCGCACAACATCGACAGCCACGCCTTCACCGGG
CCCGGCGGAGGGGCGGCGGTGACGACGGCCGAGGAGAACGAGACCAAGATGGCGCGCTTCCGGCTGCTGTGCCCG
GGCCTGTACGTGTACCACTGCGCGGCGGCGCCGGTGCCGGTGCACATCGCCAACGGCATGTACGGGCTCATGTAC
GTGCAGCCGGCCGAGGGCGACCTGCCGGCCGTCGACCGCGAGTACTACGTGATGCAGAGCGAGCTGTACCACGAG
CCGCCCGAGGTGCTCGACGACGGCCGGCCGTCCGGGACGGTCGAGTTCTCGTACCCCAACGGGCTGCGCGAGGAG
CCGAACGCGGTCGTCTTTAACGGCAGCGAGTCGGCCCTGACGCGGGACCGGCCTCTCAAGGCGGCCGCCGGCGAG
ACGGTCCGCATCTTCTTCGGCAACGCGGGGCCCAACCTGACCAGCTCGCTGCACCTCATCGGCAGCCACTTCCGG
CGCGTCTACCGCGACGGCGACGTCGTCAGCGCGCCGGGCCGCTTCGTCGGCACCGTCGCCGTCCCGCCCGGCGGC
GCCACCGTCGTCGACCTCAAGATGGTCGTCCCGGGCACCTACACCCTCGTCGACCACGCCATCTTCCGCCTCGAC
AAGGGCGCCGTCGGCTTCCTCAACGTGTCCGGGCCCCCGCGGCCCGACGTCTACGGCAGCCGCGAGCCGCCGGCG
CCGTGCGTCGGCTGCAAGCTGCACGCGTGA
Transcript >Hirsu2|10218
ATGAGCACGCAGTCCAAGACGCCAGACCATGGCCCCCGTGCTAGACTGGTATCCATGGCGGCCGCTTTCGCCACC
GTTGCGGTTGGTATCGGCATATATACCATGCGACAGGACCCATTTCAGGCGGGTTTCGCGCCGGGGAGCCGCCAG
GCCGTTTCCGAGAAGCCGCTTGCCGCCTCCATCCGTCCGGCCGGCCAGCCGTCAGACGCCAGCTTCTACGAGGCT
TTGGATGACGAAGTCCCGGACGTAGAGACGCTTCCAGTCGAGGAGGCGCAGCTTCTGAGCGCCCCCAACGTCCCC
CCACCCATCCGGCGGGACCACGCCGTGCTCCTCAAGGTGCCGCTGACGACGTCGACCAAGACGGCGCAGGTGACG
AACCAGTACAAGTACGAGCAGTGGACCTTCAACGGGACGGTGCCCGGCCCCTTCATCCGGGCGCGCGTGGGCGAC
GTGGTGGAGCTGACGCTCACGAACCGGGACGGCACGGGCAACCCGCACAACATCGACAGCCACGCCTTCACCGGG
CCCGGCGGAGGGGCGGCGGTGACGACGGCCGAGGAGAACGAGACCAAGATGGCGCGCTTCCGGCTGCTGTGCCCG
GGCCTGTACGTGTACCACTGCGCGGCGGCGCCGGTGCCGGTGCACATCGCCAACGGCATGTACGGGCTCATGTAC
GTGCAGCCGGCCGAGGGCGACCTGCCGGCCGTCGACCGCGAGTACTACGTGATGCAGAGCGAGCTGTACCACGAG
CCGCCCGAGGTGCTCGACGACGGCCGGCCGTCCGGGACGGTCGAGTTCTCGTACCCCAACGGGCTGCGCGAGGAG
CCGAACGCGGTCGTCTTTAACGGCAGCGAGTCGGCCCTGACGCGGGACCGGCCTCTCAAGGCGGCCGCCGGCGAG
ACGGTCCGCATCTTCTTCGGCAACGCGGGGCCCAACCTGACCAGCTCGCTGCACCTCATCGGCAGCCACTTCCGG
CGCGTCTACCGCGACGGCGACGTCGTCAGCGCGCCGGGCCGCTTCGTCGGCACCGTCGCCGTCCCGCCCGGCGGC
GCCACCGTCGTCGACCTCAAGATGGTCGTCCCGGGCACCTACACCCTCGTCGACCACGCCATCTTCCGCCTCGAC
AAGGGCGCCGTCGGCTTCCTCAACGTGTCCGGGCCCCCGCGGCCCGACGTCTACGGCAGCCGCGAGCCGCCGGCG
CCGTGCGTCGGCTGCAAGCTGCACGCGTGA
Gene >Hirsu2|10218
ATGAGCACGCAGTCCAAGACGCCAGACCATGGCCCCCGTGCTAGACTGGTATCCATGGCGGCCGCTTTCGCCACC
GTTGCGGTTGGTATCGGCATATATACCATGCGACAGGACCCATTTCAGGCGGGTTTCGCGCCGGGGAGCCGCCAG
GCCGTTTCCGAGAAGCCGGTGAGAGTCTCTTGAACAGGCTGTCGGGTAGCGGCAGTCCTTGTGGTCGTTCCACGC
CCGGAACACGCAGTGCACGCACATGTGAGGCCGTTACCCAGCTAACTCTGCCGCCGACTGCAAGCTTGCCGCCTC
CATCCGTCCGGCCGGCCAGCCGTCAGACGCCAGCTTCTACGAGGCTTTGGATGACGAAGTCCCGGACGTAGAGAC
GCTTCCAGTCGAGGAGGCGCAGCTTCTGAGCGCCCCCAACGTCCCCCCACCCATCCGGCGGGACCACGCCGTGCT
CCTCAAGGTGCCGCTGACGACGTCGACCAAGACGGCGCAGGTGACGAACCAGTACAAGTACGAGCAGTGGACCTT
CAACGGGACGGTGCCCGGCCCCTTCATCCGGGCGCGCGTGGGCGACGTGGTGGAGCTGACGCTCACGAACCGGGA
CGGCACGGGCAACCCGCACAACATCGACAGCCACGCCTTCACCGGGCCCGGCGGAGGGGCGGCGGTGACGACGGC
CGAGGAGAACGAGACCAAGATGGCGCGCTTCCGGCTGCTGTGCCCGGGCCTGTACGTGTACCACTGCGCGGCGGC
GCCGGTGCCGGTGCACATCGCCAACGGCATGTACGGGCTCATGTACGTGCAGCCGGCCGAGGGCGACCTGCCGGC
CGTCGACCGCGAGTACTACGTGATGCAGAGCGAGCTGTACCACGAGCCGCCCGAGGTGCTCGACGACGGCCGGCC
GTCCGGGACGGTCGAGTTCTCGTACCCCAACGGGCTGCGCGAGGAGCCGAACGCGGTCGTCTTTAACGGCAGCGA
GTCGGCCCTGACGCGGGACCGGCCTCTCAAGGCGGCCGCCGGCGAGACGGTCCGCATCTTCTTCGGCAACGCGGG
GCCCAACCTGACCAGCTCGCTGCACCTCATCGGCAGCCACTTCCGGCGCGTCTACCGCGACGGCGACGTCGTCAG
CGCGCCGGGCCGCTTCGTCGGCACCGTCGCCGTCCCGCCCGGCGGCGCCACCGTCGTCGACCTCAAGATGGTCGT
CCCGGGCACCTACACCCTCGTCGACCACGCCATCTTCCGCCTCGACAAGGGCGCCGTCGGCTTCCTCAACGTGTC
CGGGCCCCCGCGGCCCGACGTCTACGGCAGCCGCGAGCCGCCGGCGCCGTGCGTCGGCTGCAAGCTGCACGCGTG
A

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail