Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10213
Gene name
LocationContig_802:5530..11017
Strand-
Gene length (bp)5487
Transcript length (bp)5346
Coding sequence length (bp)5346
Protein length (aa) 1782

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03142 Chitin_synth_2 Chitin synthase 7.2E-250 1124 1631
PF00063 Myosin_head Myosin head (motor domain) 1.1E-74 7 679
PF08766 DEK_C DEK C terminal domain 8.2E-16 1724 1777
PF13632 Glyco_trans_2_3 Glycosyl transferase family group 2 4.4E-12 1316 1528
PF00173 Cyt-b5 Cytochrome b5-like Heme/Steroid binding domain 7.6E-09 868 936
PF13641 Glyco_tranf_2_3 Glycosyltransferase like family 2 1.3E-09 1296 1476

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4P9K9|CHS8_USTMA Chitin synthase 8 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS8 PE=3 SV=1 8 1682 0.0E+00
sp|O13395|CHS6_USTMA Chitin synthase 6 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS6 PE=3 SV=2 774 1650 0.0E+00
sp|O13353|CHS4_MAGO7 Chitin synthase 4 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CHS4 PE=3 SV=2 1150 1648 2.0E-138
sp|O13356|CHS1_CRYNH Chitin synthase 1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CHS1 PE=3 SV=2 1148 1629 7.0E-138
sp|J9VXM5|CHS3_CRYNH Chitin synthase 3 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CHS3 PE=3 SV=1 1150 1643 5.0E-136
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4P9K9|CHS8_USTMA Chitin synthase 8 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS8 PE=3 SV=1 8 1682 0.0E+00
sp|O13395|CHS6_USTMA Chitin synthase 6 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS6 PE=3 SV=2 774 1650 0.0E+00
sp|O13353|CHS4_MAGO7 Chitin synthase 4 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CHS4 PE=3 SV=2 1150 1648 2.0E-138
sp|O13356|CHS1_CRYNH Chitin synthase 1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CHS1 PE=3 SV=2 1148 1629 7.0E-138
sp|J9VXM5|CHS3_CRYNH Chitin synthase 3 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CHS3 PE=3 SV=1 1150 1643 5.0E-136
sp|P29465|CHS3_YEAST Chitin synthase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHS3 PE=1 SV=3 1150 1631 1.0E-134
sp|P78611|CHSD_EMENI Chitin synthase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chsD PE=3 SV=4 1150 1631 8.0E-132
sp|O13394|CHS5_USTMA Chitin synthase 5 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS5 PE=3 SV=3 1150 1642 9.0E-132
sp|Q01285|CHS4_NEUCR Chitin synthase 4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=chs-4 PE=3 SV=3 1149 1648 1.0E-131
sp|Q4P333|CHS7_USTMA Chitin synthase 7 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS7 PE=3 SV=1 1135 1629 8.0E-131
sp|P30573|CHS3_CANAX Chitin synthase 3 OS=Candida albicans GN=CHS3 PE=3 SV=1 1153 1623 6.0E-129
sp|Q8SSI7|CHS1_ENCCU Chitin synthase 1 OS=Encephalitozoon cuniculi (strain GB-M1) GN=CHS1 PE=2 SV=1 1090 1631 2.0E-117
sp|Q9U1M8|MYOI_DICDI Myosin-I heavy chain OS=Dictyostelium discoideum GN=myoI PE=1 SV=1 7 638 5.0E-46
sp|D3ZJP6|MYO10_RAT Unconventional myosin-X OS=Rattus norvegicus GN=Myo10 PE=1 SV=1 7 681 2.0E-45
sp|Q9HD67|MYO10_HUMAN Unconventional myosin-X OS=Homo sapiens GN=MYO10 PE=1 SV=3 7 681 4.0E-44
sp|P79114|MYO10_BOVIN Unconventional myosin-X OS=Bos taurus GN=MYO10 PE=1 SV=1 7 681 7.0E-44
sp|F8VQB6|MYO10_MOUSE Unconventional myosin-X OS=Mus musculus GN=Myo10 PE=1 SV=1 7 681 9.0E-44
sp|O43795|MYO1B_HUMAN Unconventional myosin-Ib OS=Homo sapiens GN=MYO1B PE=1 SV=3 7 679 1.0E-42
sp|Q05096|MYO1B_RAT Unconventional myosin-Ib OS=Rattus norvegicus GN=Myo1b PE=1 SV=1 7 679 1.0E-41
sp|P34092|MYOB_DICDI Myosin IB heavy chain OS=Dictyostelium discoideum GN=myoB PE=1 SV=2 7 639 6.0E-41
sp|Q876G9|MYO2_SACU7 Myosin-2 OS=Saccharomyces uvarum (strain ATCC 76518 / CBS 7001 / CLIB 283 / NBRC 10550 / MCYC 623 / NCYC 2669 / NRRL Y-11845) GN=MYO2 PE=3 SV=2 7 679 9.0E-41
sp|Q9UKN7|MYO15_HUMAN Unconventional myosin-XV OS=Homo sapiens GN=MYO15A PE=1 SV=2 7 639 1.0E-40
sp|Q6PIF6|MYO7B_HUMAN Unconventional myosin-VIIb OS=Homo sapiens GN=MYO7B PE=1 SV=2 7 638 1.0E-40
sp|P47807|MYO1A_CHICK Unconventional myosin-Ia OS=Gallus gallus GN=MYO1A PE=1 SV=2 7 679 5.0E-40
sp|Q9QZZ4|MYO15_MOUSE Unconventional myosin-XV OS=Mus musculus GN=Myo15a PE=1 SV=2 7 639 2.0E-39
sp|Q23979|MY61F_DROME Myosin-IB OS=Drosophila melanogaster GN=Myo61F PE=1 SV=3 7 512 5.0E-39
sp|P19524|MYO2_YEAST Myosin-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MYO2 PE=1 SV=1 7 679 2.0E-38
sp|Q9UBC5|MYO1A_HUMAN Unconventional myosin-Ia OS=Homo sapiens GN=MYO1A PE=1 SV=1 7 679 2.0E-38
sp|Q875Q8|MYO2_LACK1 Myosin-2 OS=Lachancea kluyveri (strain ATCC 58438 / CBS 3082 / CCRC 21498 / NBRC 1685 / JCM 7257 / NCYC 543 / NRRL Y-12651) GN=MYO2 PE=3 SV=1 7 639 4.0E-38
sp|P46735|MYO1B_MOUSE Unconventional myosin-Ib OS=Mus musculus GN=Myo1b PE=1 SV=3 7 512 5.0E-38
sp|O94832|MYO1D_HUMAN Unconventional myosin-Id OS=Homo sapiens GN=MYO1D PE=1 SV=2 7 686 6.0E-38
sp|Q99MZ6|MYO7B_MOUSE Unconventional myosin-VIIb OS=Mus musculus GN=Myo7b PE=1 SV=3 7 638 3.0E-37
sp|Q1EG27|MYO3B_MOUSE Myosin-IIIb OS=Mus musculus GN=Myo3b PE=2 SV=2 8 639 3.0E-37
sp|P32492|MYO4_YEAST Myosin-4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MYO4 PE=1 SV=1 7 639 3.0E-37
sp|P91443|HUM6_CAEEL Unconventional myosin heavy chain 6 OS=Caenorhabditis elegans GN=hum-6 PE=1 SV=1 7 488 4.0E-37
sp|Q8WXR4|MYO3B_HUMAN Myosin-IIIb OS=Homo sapiens GN=MYO3B PE=2 SV=4 8 679 5.0E-37
sp|O88329|MYO1A_MOUSE Unconventional myosin-Ia OS=Mus musculus GN=Myo1a PE=2 SV=2 7 679 7.0E-37
sp|Q8NEV4|MYO3A_HUMAN Myosin-IIIa OS=Homo sapiens GN=MYO3A PE=2 SV=2 7 639 2.0E-36
sp|Q62774|MYO1A_RAT Unconventional myosin-Ia (Fragment) OS=Rattus norvegicus GN=Myo1a PE=2 SV=1 7 679 2.0E-36
sp|Q622K8|HUM6_CAEBR Unconventional myosin heavy chain 6 OS=Caenorhabditis briggsae GN=hum-6 PE=3 SV=1 7 505 3.0E-36
sp|Q63357|MYO1D_RAT Unconventional myosin-Id OS=Rattus norvegicus GN=Myo1d PE=1 SV=3 7 686 3.0E-36
sp|Q5ZLA6|MYO1C_CHICK Unconventional myosin-Ic OS=Gallus gallus GN=MYO1C PE=2 SV=1 7 511 4.0E-36
sp|Q875X3|MYO2A_NAUCC Myosin-2A OS=Naumovozyma castellii (strain ATCC 76901 / CBS 4309 / NBRC 1992 / NRRL Y-12630) GN=MYO2A PE=3 SV=2 7 639 4.0E-36
sp|Q17R14|MYO1D_BOVIN Unconventional myosin-Id OS=Bos taurus GN=MYO1D PE=2 SV=1 7 686 7.0E-36
sp|Q92002|MYO1C_LITCT Unconventional myosin-Ic OS=Lithobates catesbeiana GN=Myo1c PE=2 SV=1 7 511 9.0E-36
sp|P42522|MYOC_DICDI Myosin IC heavy chain OS=Dictyostelium discoideum GN=myoC PE=3 SV=2 7 504 9.0E-36
sp|Q03479|MYOE_DICDI Myosin IE heavy chain OS=Dictyostelium discoideum GN=myoE PE=1 SV=2 7 488 1.0E-35
sp|Q9WTI7|MYO1C_MOUSE Unconventional myosin-Ic OS=Mus musculus GN=Myo1c PE=1 SV=2 7 499 1.0E-35
sp|Q5SYD0|MYO1D_MOUSE Unconventional myosin-Id OS=Mus musculus GN=Myo1d PE=1 SV=1 7 686 1.0E-35
sp|Q63355|MYO1C_RAT Unconventional myosin-Ic OS=Rattus norvegicus GN=Myo1c PE=1 SV=2 7 499 3.0E-35
sp|A5PF48|MYO1C_DANRE Unconventional myosin-Ic OS=Danio rerio GN=myo1c PE=3 SV=1 7 511 3.0E-35
sp|Q00647|MYO1_EMENI Myosin-1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=myoA PE=1 SV=2 7 494 1.0E-34
sp|O94477|MYO52_SCHPO Myosin-52 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=myo52 PE=1 SV=1 7 679 1.0E-34
sp|Q27966|MYO1C_BOVIN Unconventional myosin-Ic OS=Bos taurus GN=MYO1C PE=1 SV=3 7 499 1.0E-34
sp|P70569|MYO5B_RAT Unconventional myosin-Vb OS=Rattus norvegicus GN=Myo5b PE=1 SV=1 7 619 1.0E-34
sp|O00159|MYO1C_HUMAN Unconventional myosin-Ic OS=Homo sapiens GN=MYO1C PE=1 SV=4 7 499 2.0E-34
sp|Q29P71|MYO7A_DROPS Myosin-VIIa OS=Drosophila pseudoobscura pseudoobscura GN=ck PE=3 SV=1 7 491 3.0E-34
sp|P21271|MYO5B_MOUSE Unconventional myosin-Vb OS=Mus musculus GN=Myo5b PE=1 SV=2 7 619 4.0E-34
sp|P10568|MYO1A_BOVIN Unconventional myosin-Ia OS=Bos taurus GN=MYO1A PE=2 SV=1 7 679 7.0E-34
sp|Q9V3Z6|MYO7A_DROME Myosin-VIIa OS=Drosophila melanogaster GN=ck PE=1 SV=1 7 491 9.0E-34
sp|Q13402|MYO7A_HUMAN Unconventional myosin-VIIa OS=Homo sapiens GN=MYO7A PE=1 SV=2 7 491 9.0E-34
sp|Q9QY06|MYO9B_MOUSE Unconventional myosin-IXb OS=Mus musculus GN=Myo9b PE=1 SV=2 7 530 1.0E-33
sp|Q8N1T3|MYO1H_HUMAN Unconventional myosin-Ih OS=Homo sapiens GN=MYO1H PE=2 SV=2 7 514 1.0E-33
sp|Q63358|MYO9B_RAT Unconventional myosin-IXb OS=Rattus norvegicus GN=Myo9b PE=1 SV=1 7 530 1.0E-33
sp|F4I507|MYO3_ARATH Myosin-3 OS=Arabidopsis thaliana GN=VIII-A PE=2 SV=1 7 627 2.0E-33
sp|Q9Y7Z8|MYO1_SCHPO Myosin-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=myo1 PE=1 SV=1 7 488 3.0E-33
sp|P97479|MYO7A_MOUSE Unconventional myosin-VIIa OS=Mus musculus GN=Myo7a PE=1 SV=2 7 491 4.0E-33
sp|B2RTY4|MYO9A_HUMAN Unconventional myosin-IXa OS=Homo sapiens GN=MYO9A PE=1 SV=2 7 493 4.0E-33
sp|Q9LHE9|MYO1_ARATH Myosin-1 OS=Arabidopsis thaliana GN=VIII-1 PE=1 SV=1 7 627 7.0E-33
sp|Q9D6A1|MYO1H_MOUSE Unconventional myosin-Ih OS=Mus musculus GN=Myo1h PE=2 SV=2 7 514 9.0E-33
sp|Q9LKB9|MYO6_ARATH Myosin-6 OS=Arabidopsis thaliana GN=XI-2 PE=1 SV=1 7 488 2.0E-32
sp|F4I460|MYO8_ARATH Myosin-8 OS=Arabidopsis thaliana GN=XI-B PE=3 SV=1 7 488 2.0E-32
sp|Q13459|MYO9B_HUMAN Unconventional myosin-IXb OS=Homo sapiens GN=MYO9B PE=1 SV=3 7 530 2.0E-32
sp|Q1DLP2|MYO1_COCIM Myosin-1 OS=Coccidioides immitis (strain RS) GN=MYO1 PE=3 SV=1 7 488 3.0E-32
sp|Q17LW0|MYO7A_AEDAE Myosin-VIIa OS=Aedes aegypti GN=ck PE=3 SV=1 7 491 3.0E-32
sp|A0MP03|MY1CA_XENLA Unconventional myosin-Ic-A OS=Xenopus laevis GN=myo1c-a PE=1 SV=1 7 511 3.0E-32
sp|F4K0A6|MYO2_ARATH Myosin-2 OS=Arabidopsis thaliana GN=VIII-2 PE=2 SV=1 7 640 5.0E-32
sp|Q5ZMC2|MYO1G_CHICK Unconventional myosin-Ig OS=Gallus gallus GN=MYO1G PE=2 SV=1 7 679 6.0E-32
sp|Q9Z1N3|MYO9A_RAT Unconventional myosin-IXa OS=Rattus norvegicus GN=Myo9a PE=1 SV=1 7 493 7.0E-32
sp|Q9NQX4|MYO5C_HUMAN Unconventional myosin-Vc OS=Homo sapiens GN=MYO5C PE=1 SV=2 7 679 7.0E-32
sp|Q8C170|MYO9A_MOUSE Unconventional myosin-IXa OS=Mus musculus GN=Myo9a PE=1 SV=2 7 493 8.0E-32
sp|E9Q634|MYO1E_MOUSE Unconventional myosin-Ie OS=Mus musculus GN=Myo1e PE=1 SV=1 7 679 2.0E-31
sp|Q0CEX5|MYO1_ASPTN Myosin-1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=myoA PE=3 SV=1 7 488 2.0E-31
sp|F4IUG9|MYO13_ARATH Myosin-13 OS=Arabidopsis thaliana GN=XI-G PE=3 SV=1 7 488 2.0E-31
sp|Q63356|MYO1E_RAT Unconventional myosin-Ie OS=Rattus norvegicus GN=Myo1e PE=1 SV=1 7 679 2.0E-31
sp|Q4WC55|MYO1_ASPFU Myosin-1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=myoA PE=3 SV=2 7 494 2.0E-31
sp|B0Y9Q4|MYO1_ASPFC Myosin-1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=myoA PE=3 SV=2 7 494 2.0E-31
sp|Q9ULV0|MYO5B_HUMAN Unconventional myosin-Vb OS=Homo sapiens GN=MYO5B PE=1 SV=3 7 619 3.0E-31
sp|Q8K3H5|MYO3A_MOUSE Myosin-IIIa OS=Mus musculus GN=Myo3a PE=2 SV=1 7 639 4.0E-31
sp|A1DBH2|MYO1_NEOFI Myosin-1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=myoA PE=3 SV=1 7 494 4.0E-31
sp|P22467|MYOA_DICDI Myosin IA heavy chain OS=Dictyostelium discoideum GN=myoA PE=3 SV=2 7 679 5.0E-31
sp|Q12965|MYO1E_HUMAN Unconventional myosin-Ie OS=Homo sapiens GN=MYO1E PE=1 SV=2 7 679 6.0E-31
sp|F4JM19|MYO14_ARATH Myosin-14 OS=Arabidopsis thaliana GN=XI-H PE=3 SV=1 7 488 6.0E-31
sp|A8PWF6|MYO1_MALGO Myosin-1 OS=Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) GN=MYO1 PE=3 SV=2 7 561 6.0E-31
sp|A1C4A5|MYO1_ASPCL Myosin-1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=myoA PE=3 SV=2 7 494 7.0E-31
sp|A6SED8|MYO1_BOTFB Myosin-1 OS=Botryotinia fuckeliana (strain B05.10) GN=myoA PE=3 SV=2 7 488 8.0E-31
sp|Q39160|MYO5_ARATH Myosin-5 OS=Arabidopsis thaliana GN=XI-1 PE=1 SV=1 7 488 8.0E-31
sp|Q2US45|MYO1_ASPOR Myosin-1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=myoA PE=3 SV=1 7 488 9.0E-31
sp|Q9I8D1|MYO6_CHICK Unconventional myosin-VI OS=Gallus gallus GN=MYO6 PE=1 SV=1 7 488 1.0E-30
sp|Q0WPU1|MYO15_ARATH Myosin-15 OS=Arabidopsis thaliana GN=XI-I PE=1 SV=1 7 488 1.0E-30
sp|P70248|MYO1F_MOUSE Unconventional myosin-If OS=Mus musculus GN=Myo1f PE=1 SV=1 20 488 1.0E-30
sp|A7EK16|MYO1_SCLS1 Myosin-1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=myoA PE=3 SV=1 7 488 1.0E-30
sp|A2R5J1|MYO1_ASPNC Myosin-1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=myoA PE=3 SV=1 7 488 1.0E-30
sp|Q9Y6X6|MYO16_HUMAN Unconventional myosin-XVI OS=Homo sapiens GN=MYO16 PE=2 SV=3 9 679 2.0E-30
sp|O00160|MYO1F_HUMAN Unconventional myosin-If OS=Homo sapiens GN=MYO1F PE=1 SV=3 20 488 3.0E-30
sp|Q875X4|MYO2B_NAUCC Myosin-2B OS=Naumovozyma castellii (strain ATCC 76901 / CBS 4309 / NBRC 1992 / NRRL Y-12630) GN=MYO2B PE=3 SV=2 7 679 4.0E-30
sp|Q5SUA5|MYO1G_MOUSE Unconventional myosin-Ig OS=Mus musculus GN=Myo1g PE=1 SV=1 7 679 5.0E-30
sp|B0I1T2|MYO1G_HUMAN Unconventional myosin-Ig OS=Homo sapiens GN=MYO1G PE=1 SV=2 7 639 5.0E-30
sp|Q99104|MYO5A_MOUSE Unconventional myosin-Va OS=Mus musculus GN=Myo5a PE=1 SV=2 7 679 6.0E-30
sp|P54695|MYOF_DICDI Myosin IF heavy chain OS=Dictyostelium discoideum GN=myoF PE=3 SV=2 7 491 2.0E-29
sp|Q9UM54|MYO6_HUMAN Unconventional myosin-VI OS=Homo sapiens GN=MYO6 PE=1 SV=4 7 488 2.0E-29
sp|P47808|MYSH_ACACA High molecular weight form of myosin-1 OS=Acanthamoeba castellanii PE=3 SV=1 6 488 2.0E-29
sp|F4JIU4|MYO4_ARATH Myosin-4 OS=Arabidopsis thaliana GN=VIII-B PE=3 SV=1 7 679 2.0E-29
sp|P10569|MYSC_ACACA Myosin IC heavy chain OS=Acanthamoeba castellanii GN=MIC PE=1 SV=1 7 488 3.0E-29
sp|Q9QYF3|MYO5A_RAT Unconventional myosin-Va OS=Rattus norvegicus GN=Myo5a PE=1 SV=1 7 679 3.0E-29
sp|Q28970|MYO7A_PIG Unconventional myosin-VIIa (Fragment) OS=Sus scrofa GN=MYO7A PE=2 SV=1 7 459 3.0E-29
sp|Q9Y4I1|MYO5A_HUMAN Unconventional myosin-Va OS=Homo sapiens GN=MYO5A PE=1 SV=2 7 679 4.0E-29
sp|Q5DU14|MYO16_MOUSE Unconventional myosin-XVI OS=Mus musculus GN=Myo16 PE=1 SV=2 8 679 5.0E-29
sp|Q29122|MYO6_PIG Unconventional myosin-VI OS=Sus scrofa GN=MYO6 PE=1 SV=1 7 488 7.0E-29
sp|Q9M2K0|MYO16_ARATH Myosin-16 OS=Arabidopsis thaliana GN=XI-J PE=2 SV=1 11 488 8.0E-29
sp|F4IRU3|MYO12_ARATH Myosin-12 OS=Arabidopsis thaliana GN=XI-F PE=2 SV=1 7 488 1.0E-28
sp|Q9TW28|MYOM_DICDI Myosin-M heavy chain OS=Dictyostelium discoideum GN=myoM PE=1 SV=1 7 493 1.0E-28
sp|A4RE77|MYO1_MAGO7 Myosin-1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MYO1 PE=3 SV=1 7 488 1.0E-28
sp|P08799|MYS2_DICDI Myosin-2 heavy chain OS=Dictyostelium discoideum GN=mhcA PE=1 SV=3 7 619 1.0E-28
sp|P34109|MYOD_DICDI Myosin ID heavy chain OS=Dictyostelium discoideum GN=myoD PE=1 SV=2 7 488 2.0E-28
sp|P10676|NINAC_DROME Neither inactivation nor afterpotential protein C OS=Drosophila melanogaster GN=ninaC PE=1 SV=2 7 679 2.0E-28
sp|P19706|MYSB_ACACA Myosin heavy chain IB OS=Acanthamoeba castellanii GN=MIB PE=1 SV=2 7 494 2.0E-28
sp|P0CP00|MYO1_CRYNJ Myosin-1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=MYO1 PE=3 SV=1 7 488 3.0E-28
sp|P0CP01|MYO1_CRYNB Myosin-1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=MYO1 PE=3 SV=1 7 488 3.0E-28
sp|P36006|MYO3_YEAST Myosin-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MYO3 PE=1 SV=4 7 491 4.0E-28
sp|A6ZZJ1|MYO3_YEAS7 Myosin-3 OS=Saccharomyces cerevisiae (strain YJM789) GN=MYO3 PE=3 SV=1 7 491 5.0E-28
sp|O74805|MYO51_SCHPO Myosin-51 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=myo51 PE=3 SV=1 7 679 6.0E-28
sp|Q59MQ0|MYO5_CANAL Myosin-5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MYO5 PE=1 SV=1 7 497 6.0E-28
sp|Q01989|MYS9_DROME Myosin heavy chain 95F OS=Drosophila melanogaster GN=jar PE=2 SV=4 7 488 9.0E-28
sp|A5E4A8|MYO1_LODEL Myosin-1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=MYO1 PE=3 SV=1 7 679 1.0E-27
sp|Q2HDI2|MYO1_CHAGB Myosin-1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=MYO1 PE=3 SV=1 7 494 1.0E-27
sp|Q02440|MYO5A_CHICK Unconventional myosin-Va OS=Gallus gallus GN=MYO5A PE=1 SV=1 7 679 1.0E-27
sp|P54696|MYOH_DICDI Myosin-H heavy chain OS=Dictyostelium discoideum GN=myoH PE=3 SV=3 7 619 1.0E-27
sp|F4IVR7|MYO10_ARATH Myosin-10 OS=Arabidopsis thaliana GN=XI-D PE=3 SV=1 7 488 2.0E-27
sp|F4HWY6|MYO11_ARATH Myosin-11 OS=Arabidopsis thaliana GN=XI-E PE=3 SV=1 7 488 2.0E-27
sp|A5DKH0|MYO1_PICGU Myosin-1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=MYO1 PE=3 SV=3 7 497 2.0E-27
sp|Q96H55|MYO19_HUMAN Unconventional myosin-XIX OS=Homo sapiens GN=MYO19 PE=1 SV=2 21 619 3.0E-27
sp|Q7SDM3|MYO1_NEUCR Myosin-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=myo-1 PE=3 SV=1 7 490 3.0E-27
sp|O00934|MYOA_TOXGO Myosin-A OS=Toxoplasma gondii PE=1 SV=1 8 681 7.0E-27
sp|F4K5J1|MYO17_ARATH Myosin-17 OS=Arabidopsis thaliana GN=XI-K PE=1 SV=2 7 488 7.0E-27
sp|Q9ERC1|MYO16_RAT Unconventional myosin-XVI OS=Rattus norvegicus GN=Myo16 PE=1 SV=1 8 679 1.0E-26
sp|Q9UAR6|MYOA_PLAFB Myosin-A OS=Plasmodium falciparum (isolate FCBR / Columbia) PE=2 SV=1 8 488 2.0E-26
sp|Q8IDR3|MYOA_PLAF7 Myosin-A OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0233 PE=1 SV=1 8 488 2.0E-26
sp|F4HXP9|MYO9_ARATH Myosin-9 OS=Arabidopsis thaliana GN=XI-C PE=2 SV=1 7 488 3.0E-26
sp|P05659|MYSN_ACACA Myosin-2 heavy chain, non muscle OS=Acanthamoeba castellanii PE=3 SV=1 7 493 4.0E-26
sp|Q6C7C0|MYO1_YARLI Myosin-1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MYO1 PE=3 SV=1 7 488 6.0E-26
sp|Q23978|MY31D_DROME Myosin-IA OS=Drosophila melanogaster GN=Myo31DF PE=2 SV=1 7 511 8.0E-26
sp|Q9XXV8|MYOK_DICDI Myosin-K heavy chain OS=Dictyostelium discoideum GN=myoK PE=2 SV=1 40 511 1.0E-25
sp|F4I5Q6|MYO7_ARATH Myosin-7 OS=Arabidopsis thaliana GN=XI-A PE=3 SV=1 7 468 2.0E-25
sp|Q04439|MYO5_YEAST Myosin-5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MYO5 PE=1 SV=1 7 488 2.0E-25
sp|A6ZMG6|MYO5_YEAS7 Myosin-5 OS=Saccharomyces cerevisiae (strain YJM789) GN=MYO5 PE=3 SV=1 7 488 2.0E-25
sp|Q6FMJ3|MYO3_CANGA Myosin-3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MYO3 PE=3 SV=1 7 497 2.0E-25
sp|A8N2Y6|MYO1_COPC7 Myosin-1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=MYO1 PE=3 SV=2 7 488 3.0E-25
sp|A3LYL7|MYO1_PICST Myosin-1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=MYO1 PE=3 SV=2 7 497 4.0E-25
sp|Q758Q9|MYO1_ASHGO Myosin-1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MYO1 PE=3 SV=2 7 488 6.0E-25
sp|Q7RQ71|MYOA_PLAYO Myosin-A OS=Plasmodium yoelii yoelii GN=PY01232 PE=1 SV=1 8 488 1.0E-24
sp|Q86AC8|MYOG_DICDI Myosin-G heavy chain OS=Dictyostelium discoideum GN=myoG PE=3 SV=1 22 625 1.0E-24
sp|Q7Z8J6|MYO1_USTMA Myosin-1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=myo1 PE=3 SV=1 7 488 1.0E-24
sp|Q5SV80|MYO19_MOUSE Unconventional myosin-XIX OS=Mus musculus GN=Myo19 PE=2 SV=1 21 619 2.0E-24
sp|B0CRJ3|MYO1_LACBS Myosin-1 OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=MYO1 PE=3 SV=2 7 679 3.0E-24
sp|P08964|MYO1_YEAST Myosin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MYO1 PE=1 SV=3 7 638 7.0E-24
sp|Q6FN18|MYO5_CANGA Myosin-5 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MYO5 PE=3 SV=1 7 488 1.0E-23
sp|Q6BUQ2|MYO1_DEBHA Myosin-1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=MYO1 PE=3 SV=2 7 497 2.0E-23
sp|P54697|MYOJ_DICDI Myosin-J heavy chain OS=Dictyostelium discoideum GN=myoJ PE=3 SV=2 7 638 3.0E-23
sp|Q6CVE9|MYO1_KLULA Myosin-1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MYO1 PE=3 SV=1 7 488 3.0E-23
sp|Q569U0|MYO19_XENLA Unconventional myosin-XIX OS=Xenopus laevis GN=myo19 PE=2 SV=1 21 491 5.0E-23
sp|O00936|MYOB_TOXGO Myosin-B/C OS=Toxoplasma gondii PE=2 SV=4 20 488 1.0E-21
sp|A7TDZ8|MYO1_VANPO Myosin-1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=MYO1 PE=3 SV=1 7 488 1.0E-20
sp|Q9USI6|MYO2_SCHPO Myosin type-2 heavy chain 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=myo2 PE=1 SV=1 7 678 3.0E-19
sp|Q8SS35|Y4A0_ENCCU Probable myosin heavy chain ECU04_1000 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU04_1000 PE=1 SV=2 7 487 7.0E-19
sp|Q9XYF6|MYOD_TOXGO Myosin-D OS=Toxoplasma gondii PE=2 SV=1 10 488 1.0E-18
sp|P24733|MYS_ARGIR Myosin heavy chain, striated muscle OS=Argopecten irradians PE=1 SV=1 7 488 2.0E-18
sp|Q64331|MYO6_MOUSE Unconventional myosin-VI OS=Mus musculus GN=Myo6 PE=1 SV=1 7 398 4.0E-18
sp|O08638|MYH11_MOUSE Myosin-11 OS=Mus musculus GN=Myh11 PE=1 SV=1 7 619 4.0E-18
sp|Q8VDD5|MYH9_MOUSE Myosin-9 OS=Mus musculus GN=Myh9 PE=1 SV=4 7 488 8.0E-18
sp|Q62812|MYH9_RAT Myosin-9 OS=Rattus norvegicus GN=Myh9 PE=1 SV=3 7 488 9.0E-18
sp|P35579|MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 7 488 9.0E-18
sp|Q258K2|MYH9_CANLF Myosin-9 OS=Canis lupus familiaris GN=MYH9 PE=2 SV=1 7 488 1.0E-17
sp|Q63862|MYH11_RAT Myosin-11 (Fragments) OS=Rattus norvegicus GN=Myh11 PE=1 SV=3 7 488 1.0E-17
sp|P14105|MYH9_CHICK Myosin-9 OS=Gallus gallus GN=MYH9 PE=2 SV=1 7 488 1.0E-17
sp|Q61879|MYH10_MOUSE Myosin-10 OS=Mus musculus GN=Myh10 PE=1 SV=2 20 488 4.0E-17
sp|Q27991|MYH10_BOVIN Myosin-10 OS=Bos taurus GN=MYH10 PE=2 SV=2 20 488 5.0E-17
sp|P35748|MYH11_RABIT Myosin-11 OS=Oryctolagus cuniculus GN=MYH11 PE=2 SV=2 7 488 5.0E-17
sp|P35749|MYH11_HUMAN Myosin-11 OS=Homo sapiens GN=MYH11 PE=1 SV=3 7 488 6.0E-17
sp|P35580|MYH10_HUMAN Myosin-10 OS=Homo sapiens GN=MYH10 PE=1 SV=3 20 488 6.0E-17
sp|O14157|MYO3_SCHPO Myosin type-2 heavy chain 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=myo3 PE=1 SV=1 8 488 8.0E-17
sp|P10587|MYH11_CHICK Myosin-11 OS=Gallus gallus GN=MYH11 PE=1 SV=4 7 619 8.0E-17
sp|P12844|MYO3_CAEEL Myosin-3 OS=Caenorhabditis elegans GN=myo-3 PE=2 SV=1 7 464 1.0E-16
sp|Q60LV4|MYO3_CAEBR Myosin-3 OS=Caenorhabditis briggsae GN=myo-3 PE=3 SV=1 7 464 3.0E-16
sp|P17862|NODC_RHILO N-acetylglucosaminyltransferase OS=Rhizobium loti (strain MAFF303099) GN=nodC PE=3 SV=2 1302 1593 3.0E-16
sp|Q9JLT0|MYH10_RAT Myosin-10 OS=Rattus norvegicus GN=Myh10 PE=1 SV=1 22 488 5.0E-16
sp|P54267|CHSG_ASPFU Chitin synthase G OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=chsG PE=2 SV=2 1241 1479 8.0E-16
sp|Q9Y2K3|MYH15_HUMAN Myosin-15 OS=Homo sapiens GN=MYH15 PE=1 SV=5 7 488 9.0E-16
sp|Q00757|CHSB_EMENI Chitin synthase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chsB PE=2 SV=2 1241 1479 2.0E-15
sp|P04340|NODC_RHILV N-acetylglucosaminyltransferase OS=Rhizobium leguminosarum bv. viciae GN=nodC PE=3 SV=1 1301 1489 2.0E-15
sp|Q07755|NODC_AZOC5 N-acetylglucosaminyltransferase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=nodC PE=3 SV=2 1312 1593 1.0E-14
sp|P04341|NODC_RHIME N-acetylglucosaminyltransferase OS=Rhizobium meliloti (strain 1021) GN=nodC PE=3 SV=1 1312 1617 1.0E-14
sp|P29070|CHS1_NEUCR Chitin synthase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=chs-1 PE=3 SV=2 1241 1479 4.0E-14
sp|O35776|HYAS2_RAT Hyaluronan synthase 2 OS=Rattus norvegicus GN=Has2 PE=2 SV=1 1116 1478 4.0E-14
sp|P11055|MYH3_HUMAN Myosin-3 OS=Homo sapiens GN=MYH3 PE=1 SV=3 7 489 6.0E-14
sp|O57427|HYAS2_XENLA Hyaluronan synthase 2 OS=Xenopus laevis GN=has2 PE=2 SV=2 1115 1478 6.0E-14
sp|P13541|MYH3_MOUSE Myosin-3 OS=Mus musculus GN=Myh3 PE=2 SV=2 7 489 8.0E-14
sp|P70312|HYAS2_MOUSE Hyaluronan synthase 2 OS=Mus musculus GN=Has2 PE=1 SV=4 1116 1478 2.0E-13
sp|G5AY81|HYAS2_HETGA Hyaluronan synthase 2 OS=Heterocephalus glaber GN=Has2 PE=3 SV=1 1116 1478 3.0E-13
sp|O00219|HYAS3_HUMAN Hyaluronan synthase 3 OS=Homo sapiens GN=HAS3 PE=2 SV=3 1115 1478 3.0E-13
sp|Q92819|HYAS2_HUMAN Hyaluronan synthase 2 OS=Homo sapiens GN=HAS2 PE=2 SV=1 1116 1478 4.0E-13
sp|P26024|NODC_BRADU N-acetylglucosaminyltransferase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=nodC PE=3 SV=2 1302 1609 5.0E-13
sp|P12847|MYH3_RAT Myosin-3 OS=Rattus norvegicus GN=Myh3 PE=3 SV=1 7 489 5.0E-13
sp|P50356|NODC_RHIGA N-acetylglucosaminyltransferase OS=Rhizobium galegae GN=nodC PE=3 SV=1 1302 1489 7.0E-13
sp|P50357|NODC_RHISN N-acetylglucosaminyltransferase OS=Rhizobium sp. (strain NGR234) GN=nodC PE=3 SV=2 1302 1482 8.0E-13
sp|P30602|CHS3_EXODE Chitin synthase 3 OS=Exophiala dermatitidis GN=CHS3 PE=3 SV=2 1241 1479 8.0E-13
sp|Q7Z406|MYH14_HUMAN Myosin-14 OS=Homo sapiens GN=MYH14 PE=1 SV=2 20 488 9.0E-13
sp|P02567|MYO1_CAEEL Myosin-1 OS=Caenorhabditis elegans GN=myo-1 PE=1 SV=3 7 480 1.0E-12
sp|O97711|HYAS2_BOVIN Hyaluronan synthase 2 OS=Bos taurus GN=HAS2 PE=2 SV=1 1116 1478 3.0E-12
sp|Q99127|CHS4_USTMA Chitin synthase 4 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS4 PE=3 SV=2 1317 1578 4.0E-12
sp|P48017|CHS_SAPMO Chitin synthase OS=Saprolegnia monoica GN=CHS PE=3 SV=1 1306 1479 4.0E-12
sp|O08650|HYAS3_MOUSE Hyaluronan synthase 3 OS=Mus musculus GN=Has3 PE=1 SV=2 1115 1478 5.0E-12
sp|Q99323|MYSN_DROME Myosin heavy chain, non-muscle OS=Drosophila melanogaster GN=zip PE=1 SV=2 53 638 5.0E-12
sp|F1PT61|MYH16_CANLF Myosin-16 OS=Canis lupus familiaris GN=MYH16 PE=3 SV=2 7 491 7.0E-12
sp|O57424|HYAS2_CHICK Hyaluronan synthase 2 OS=Gallus gallus GN=HAS2 PE=2 SV=2 1119 1478 7.0E-12
sp|P05661|MYSA_DROME Myosin heavy chain, muscle OS=Drosophila melanogaster GN=Mhc PE=1 SV=4 7 495 1.0E-11
sp|P30584|CHSA_EMENI Chitin synthase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chsA PE=3 SV=2 1317 1477 2.0E-11
sp|Q92197|CHSC_ASPFU Chitin synthase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=chsC PE=3 SV=2 1241 1479 2.0E-11
sp|P02565|MYH3_CHICK Myosin-3 OS=Gallus gallus GN=MYH3 PE=2 SV=3 7 651 2.0E-11
sp|P30598|CHS1_USTMA Chitin synthase 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS1 PE=3 SV=3 1312 1487 3.0E-11
sp|P30599|CHS2_USTMA Chitin synthase 2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS2 PE=3 SV=2 1317 1480 3.0E-11
sp|B1WB39|HYAS1_XENTR Hyaluronan synthase 1 OS=Xenopus tropicalis GN=has1 PE=2 SV=1 1114 1478 3.0E-11
sp|P12845|MYO2_CAEEL Myosin-2 OS=Caenorhabditis elegans GN=myo-2 PE=1 SV=2 7 481 3.0E-11
sp|P72334|NODC_RHIS3 N-acetylglucosaminyltransferase OS=Rhizobium sp. (strain N33) GN=nodC PE=3 SV=1 1312 1482 6.0E-11
sp|P78746|CHSD_ASPFU Chitin synthase D OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=chsD PE=3 SV=1 1153 1601 6.0E-11
sp|Q9BE40|MYH1_BOVIN Myosin-1 OS=Bos taurus GN=MYH1 PE=2 SV=2 7 489 1.0E-10
sp|Q12564|CHSA_AMPQU Chitin synthase A OS=Ampelomyces quisqualis GN=CHSA PE=3 SV=1 1317 1479 1.0E-10
sp|A2AQP0|MYH7B_MOUSE Myosin-7B OS=Mus musculus GN=Myh7b PE=3 SV=1 7 678 2.0E-10
sp|P30583|CHSC_EMENI Chitin synthase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chsC PE=3 SV=3 1317 1479 2.0E-10
sp|Q92444|CHS2_PARBR Chitin synthase 2 OS=Paracoccidioides brasiliensis GN=CHS2 PE=3 SV=2 1317 1486 2.0E-10
sp|Q92839|HYAS1_HUMAN Hyaluronan synthase 1 OS=Homo sapiens GN=HAS1 PE=1 SV=2 1318 1478 2.0E-10
sp|Q61647|HYAS1_MOUSE Hyaluronan synthase 1 OS=Mus musculus GN=Has1 PE=1 SV=1 1318 1478 2.0E-10
sp|P30601|CHS2_EXODE Chitin synthase 2 OS=Exophiala dermatitidis GN=CHS2 PE=3 SV=2 1317 1479 4.0E-10
sp|Q90339|MYSS_CYPCA Myosin heavy chain, fast skeletal muscle OS=Cyprinus carpio PE=2 SV=2 7 489 4.0E-10
sp|P30589|CHS2_NEUCR Chitin synthase 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=chs-2 PE=3 SV=4 1216 1486 5.0E-10
sp|A7E2Y1|MYH7B_HUMAN Myosin-7B OS=Homo sapiens GN=MYH7B PE=1 SV=3 7 619 5.0E-10
sp|Q8MJV1|MYH2_HORSE Myosin-2 OS=Equus caballus GN=MYH2 PE=2 SV=1 7 489 6.0E-10
sp|P08004|CHS1_YEAST Chitin synthase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHS1 PE=1 SV=2 1317 1479 8.0E-10
sp|P87073|CHS1_PHYB8 Chitin synthase 1 OS=Phycomyces blakesleeanus (strain ATCC 8743b / FGSC 10004 / NBRC 33097 / NRRL 1555) GN=chs1 PE=3 SV=1 1317 1479 9.0E-10
sp|Q6URW6|MYH14_MOUSE Myosin-14 OS=Mus musculus GN=Myh14 PE=1 SV=1 20 488 9.0E-10
sp|Q076A7|MYH2_CANLF Myosin-2 OS=Canis lupus familiaris GN=MYH2 PE=3 SV=1 7 489 1.0E-09
sp|Q8MJV0|MYH1_HORSE Myosin-1 OS=Equus caballus GN=MYH1 PE=2 SV=1 7 489 1.0E-09
sp|P30600|CHS1_EXODE Chitin synthase 1 OS=Exophiala dermatitidis GN=CHS1 PE=3 SV=2 1320 1477 2.0E-09
sp|Q9UKX2|MYH2_HUMAN Myosin-2 OS=Homo sapiens GN=MYH2 PE=1 SV=1 7 489 2.0E-09
sp|Q9TV62|MYH4_PIG Myosin-4 OS=Sus scrofa GN=MYH4 PE=2 SV=1 7 490 2.0E-09
sp|P30572|CHS2_CANAX Chitin synthase 2 OS=Candida albicans GN=CHS2 PE=2 SV=2 1317 1479 2.0E-09
sp|Q9TV61|MYH1_PIG Myosin-1 OS=Sus scrofa GN=MYH1 PE=2 SV=1 7 488 2.0E-09
sp|P13563|HYAS1_XENLA Hyaluronan synthase 1 OS=Xenopus laevis GN=has1 PE=1 SV=1 1114 1478 4.0E-09
sp|P13542|MYH8_MOUSE Myosin-8 OS=Mus musculus GN=Myh8 PE=2 SV=2 7 489 6.0E-09
sp|P30595|CHS2_RHIOL Chitin synthase 2 OS=Rhizopus oligosporus GN=CHS2 PE=3 SV=1 1317 1479 6.0E-09
sp|Q9BE41|MYH2_BOVIN Myosin-2 OS=Bos taurus GN=MYH2 PE=2 SV=1 7 489 7.0E-09
sp|Q91Z83|MYH7_MOUSE Myosin-7 OS=Mus musculus GN=Myh7 PE=1 SV=1 7 489 8.0E-09
sp|P13538|MYSS_CHICK Myosin heavy chain, skeletal muscle, adult OS=Gallus gallus PE=1 SV=4 7 489 1.0E-08
sp|P02564|MYH7_RAT Myosin-7 OS=Rattus norvegicus GN=Myh7 PE=1 SV=2 7 489 1.0E-08
sp|P13535|MYH8_HUMAN Myosin-8 OS=Homo sapiens GN=MYH8 PE=1 SV=3 7 489 1.0E-08
sp|Q9TV63|MYH2_PIG Myosin-2 OS=Sus scrofa GN=MYH2 PE=2 SV=1 7 489 1.0E-08
sp|P12882|MYH1_HUMAN Myosin-1 OS=Homo sapiens GN=MYH1 PE=1 SV=3 7 488 1.0E-08
sp|Q076A5|MYH4_CANLF Myosin-4 OS=Canis lupus familiaris GN=MYH4 PE=3 SV=1 7 492 2.0E-08
sp|P14180|CHS2_YEAST Chitin synthase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHS2 PE=1 SV=1 1317 1477 2.0E-08
sp|Q076A4|MYH8_CANLF Myosin-8 OS=Canis lupus familiaris GN=MYH8 PE=3 SV=1 7 489 2.0E-08
sp|P30597|CHS1_SCHPO Chitin synthase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chs1 PE=3 SV=2 1312 1479 2.0E-08
sp|P30594|CHS1_RHIOL Chitin synthase 1 OS=Rhizopus oligosporus GN=CHS1 PE=3 SV=1 1317 1479 3.0E-08
sp|P02563|MYH6_RAT Myosin-6 OS=Rattus norvegicus GN=Myh6 PE=1 SV=2 7 489 3.0E-08
sp|Q02566|MYH6_MOUSE Myosin-6 OS=Mus musculus GN=Myh6 PE=1 SV=2 7 489 3.0E-08
sp|P13540|MYH7_MESAU Myosin-7 OS=Mesocricetus auratus GN=MYH7 PE=2 SV=2 7 489 4.0E-08
sp|P79293|MYH7_PIG Myosin-7 OS=Sus scrofa GN=MYH7 PE=2 SV=2 7 489 4.0E-08
sp|Q9Y623|MYH4_HUMAN Myosin-4 OS=Homo sapiens GN=MYH4 PE=1 SV=2 7 489 4.0E-08
sp|P13533|MYH6_HUMAN Myosin-6 OS=Homo sapiens GN=MYH6 PE=1 SV=5 7 489 5.0E-08
sp|P23316|CHS1_CANAX Chitin synthase 1 OS=Candida albicans GN=CHS1 PE=2 SV=2 1310 1477 5.0E-08
sp|P12883|MYH7_HUMAN Myosin-7 OS=Homo sapiens GN=MYH7 PE=1 SV=5 7 489 5.0E-08
sp|Q5SX40|MYH1_MOUSE Myosin-1 OS=Mus musculus GN=Myh1 PE=1 SV=1 7 488 6.0E-08
sp|Q8MJU9|MYH7_HORSE Myosin-7 OS=Equus caballus GN=MYH7 PE=2 SV=1 7 489 6.0E-08
sp|Q28641|MYH4_RABIT Myosin-4 OS=Oryctolagus cuniculus GN=MYH4 PE=2 SV=1 7 488 7.0E-08
sp|Q9BE39|MYH7_BOVIN Myosin-7 OS=Bos taurus GN=MYH7 PE=2 SV=1 7 489 1.0E-07
sp|Q12632|CHS1_MUCCL Chitin synthase 1 OS=Mucor circinelloides f. lusitanicus GN=CHS1 PE=3 SV=1 1362 1486 1.0E-07
sp|P13539|MYH6_MESAU Myosin-6 OS=Mesocricetus auratus GN=MYH6 PE=2 SV=2 7 489 1.0E-07
sp|Q5SX39|MYH4_MOUSE Myosin-4 OS=Mus musculus GN=Myh4 PE=2 SV=1 7 489 2.0E-07
sp|P49824|MYH7_CANLF Myosin-7 OS=Canis lupus familiaris GN=MYH7 PE=1 SV=3 7 489 2.0E-07
sp|Q29RW1|MYH4_RAT Myosin-4 OS=Rattus norvegicus GN=Myh4 PE=1 SV=1 7 489 2.0E-07
sp|Q076A3|MYH13_CANLF Myosin-13 OS=Canis lupus familiaris GN=MYH13 PE=3 SV=1 7 489 3.0E-07
sp|Q076A6|MYH1_CANLF Myosin-1 OS=Canis lupus familiaris GN=MYH1 PE=3 SV=2 7 489 4.0E-07
sp|P30588|CHS3_NEUCR Chitin synthase 3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=chs-3 PE=3 SV=2 1317 1487 7.0E-07
sp|P02566|MYO4_CAEEL Myosin-4 OS=Caenorhabditis elegans GN=unc-54 PE=1 SV=2 7 480 1.0E-06
sp|Q99126|CHS3_USTMA Chitin synthase 3 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS3 PE=3 SV=2 1362 1479 1.0E-06
sp|Q9UKX3|MYH13_HUMAN Myosin-13 OS=Homo sapiens GN=MYH13 PE=2 SV=2 7 489 2.0E-06
sp|O57428|HASR_XENLA Hyaluronan synthase-related protein OS=Xenopus laevis GN=has-rs PE=1 SV=2 1312 1478 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003774 motor activity Yes
GO:0005524 ATP binding Yes
GO:0016459 myosin complex Yes
GO:0044446 intracellular organelle part No
GO:0017076 purine nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0044430 cytoskeletal part No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0032991 protein-containing complex No
GO:0044424 intracellular part No
GO:0043168 anion binding No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0017111 nucleoside-triphosphatase activity No
GO:0032555 purine ribonucleotide binding No
GO:0044464 cell part No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032553 ribonucleotide binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0030554 adenyl nucleotide binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0044422 organelle part No
GO:0036094 small molecule binding No
GO:0008144 drug binding No
GO:0003674 molecular_function No
GO:0016462 pyrophosphatase activity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

Domain # Start End Length
1 801 820 19
2 841 860 19
3 1504 1526 22
4 1533 1555 22
5 1565 1587 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10213
MAGAEDMADRAWLRLGHRSESQAIVFLGESGSGKSTVRNHLLSALLDKSSTPLSTKLSLAAYVFDTLTTTKTATT
PTASKSGLFYELQYDTSSTTNPILIGGKVLDHRLERSRITDVPTGERNFHILYYLLAGTSEAEKTHLGLDGSKRW
KYLGHPTQLKVGINDAEGFQLFKSALRKLEFPRGEIAEICQVLATILHIGQLEFETTSNTSATGDDSGGFSHEGG
VITTTVKNKDVLAIIAAFLGVSNGDLQNTLGYKTKMIQKERVTVMLDPNGARAHANELARTLYALLVAWIIENAN
QRVCALEDGIANTISLVDFPGFAQQSSTRSTLDQLLNNAATEAVYNMALHNFFDRKAEMLESEEVSVTPTSYFDN
SDAVKGLLKAGNGLLSILDDQTRRNRTDIQLLESLRKRFEGKNPAIEVSSATAKLPGSNFLTENAAASFTVKHFA
GEVDYPVKGLIEENGEIISVDLLNMFNATKSEFVARLFGQDALQTISHPNEKTAVLQASVSSKPMRAPSVMSRKG
GRGRALATQRWHQDSAEQRADNAKTVKNGTSKGPTEQGASGQFLSSLDNVQKVVTDPGTNAYFVFCLKPNDRRIA
NQFDSKCVRTQVQTFGIAEISQRLRSADFSLFLPFGEFLGMADAETILVGSERERVEMVIDEKRWPSNEVQVGST
GVFLSERCWLEVAHLSEKGGSLGRFGSLAESQGGDGLPAGEQHAFVASKEQLLSAGNTPLMYGEKGKAGGYFTGS
DDTRSEAGVSALGAGDMFKNLDTREQMAERGNEKSLEEVEEFKDSPSRKRWVFTVYFLTWFIPDFLIRWVGRMPR
KDVRMAWREKVAINMLIWFLCLVAAFFIVVFPMLICPKQNVFSAEELSAYDGKEGSKGAYASIRGYVIDLGAYAP
RHYPNYLGTKSLLNYAGKDISSLFPLQVSALCQGATGSVNEEVTLDYKNVNLTGSPNLINSQDINAKYHDFRYFT
NDTRPDWYLEQLLTLRGNWGKGNIGYSPEYVKKLAQKEQTIAIIGSKVYDLTTYVRGGLKMRAKSGEKPPNDPSL
INFMDSSVMTLFQLKAGEDITKYWDSLAIGGDMKKRMQTCLDYLFYVGDVDTRNSTRCQFAEYLVLAVSILLASV
IAFKFFAALQFGGKNVPENLDKFVLCQIPAYTEDEDSLRRAIDSAARMRYDDKRKLLVIVCDGMIIGQGNDRPTP
RIVLDILGVSETVDPEPLSFESLGEGQKQHNMGKVYSGLYEVQGHIVPFMVIVKVGKPSEVVRPGNRGKRDSQMV
VMRFLNRVHYNLSMSPLELEMYHQIRNIIGVNPTFYEFMLQIDADTVVAPDSATRMVSAFLDDTRLIAVCGETAL
TNAKSSFITMIQVYEYYISHNLSKAFESLFGSVTCLPGCFSMYRIRAAETGKPLFVSREVVESYATIRVDTLHMK
NLLHLGEDRYLTTLLLKFHSKYKTKYIFTAHAWTIAPDSWQVFLSQRRRWINSTVHNLIELIPMNQLCGFCCFSM
RFIVFVDLLSTVVQPVTIAYIVYLIVLVATRTTVVPITAFVLLGVIYGLQAIIFILRRKWEMVGWMVLYVLAIPV
FSFGLPLYAFWHMDDFNWGNTRVVAGEKGKKVVISDEGKFDPGSIPRKKWEEYQAELWETQTSRDDTRSEISGFS
YGTKAQALVSEYAFPSRPDSTTGFAAHPSASHLPPYDSRNVSRMSLAASEMGGNRMSHFSGSQFFNPDDMVGLPS
DDALLAEIRDILRTADLMTVTKKGVKQELERRFDVPLDTKRAYINSATEAILSGQL*
Coding >Hirsu2|10213
ATGGCCGGCGCCGAAGACATGGCTGACCGCGCTTGGTTGAGGCTGGGCCATCGATCCGAGAGCCAGGCCATCGTC
TTCCTCGGTGAGTCTGGGTCTGGCAAGTCGACCGTCCGCAACCATCTCCTTTCGGCGTTGCTCGACAAGTCCTCC
ACACCCCTATCAACGAAGCTCTCTCTGGCCGCCTATGTCTTCGACACCCTCACTACGACCAAGACTGCTACTACG
CCGACGGCCTCCAAGTCCGGCCTCTTCTACGAGCTTCAATACGACACCTCAAGCACGACCAATCCGATCCTCATC
GGCGGCAAGGTGTTGGATCACAGGCTCGAGAGGAGCCGCATTACGGACGTGCCGACCGGTGAGAGGAATTTCCAC
ATCTTGTACTACCTCTTGGCCGGCACCAGTGAGGCCGAGAAGACTCATCTTGGCCTTGACGGGTCAAAGAGATGG
AAATATCTCGGACACCCGACTCAGCTCAAGGTGGGCATTAATGACGCCGAGGGCTTCCAACTTTTCAAGAGTGCC
TTGAGGAAGCTCGAGTTCCCCAGAGGCGAGATCGCGGAGATTTGTCAAGTTCTGGCCACCATTCTCCACATCGGT
CAGCTCGAATTCGAGACAACCAGCAACACCAGCGCCACCGGCGATGACAGCGGCGGCTTCTCCCACGAAGGCGGC
GTCATCACAACGACCGTCAAGAATAAGGACGTCCTCGCCATCATTGCTGCCTTTCTCGGCGTCAGCAACGGCGAC
CTCCAGAACACACTGGGCTACAAGACGAAGATGATACAGAAGGAGCGCGTCACCGTGATGTTGGACCCTAATGGT
GCCCGTGCTCACGCCAACGAGCTGGCCCGCACCCTGTATGCTCTTTTGGTTGCGTGGATCATCGAAAATGCCAAC
CAGAGAGTCTGTGCGCTGGAAGATGGCATCGCCAACACCATTTCCCTGGTCGACTTCCCCGGCTTTGCACAGCAG
TCATCGACCAGATCCACCCTTGACCAGCTCCTGAACAATGCAGCCACCGAGGCAGTGTACAACATGGCGCTGCAC
AATTTCTTTGACCGCAAAGCCGAGATGCTCGAGTCCGAGGAGGTCAGCGTCACCCCCACGAGCTACTTTGACAAT
TCCGACGCCGTCAAAGGCCTGCTCAAGGCTGGAAATGGCCTCCTCAGTATTCTTGATGACCAGACACGGAGAAAC
AGGACGGACATTCAGCTCCTCGAGAGCCTGCGAAAGCGCTTCGAAGGTAAGAATCCGGCGATAGAAGTCAGTTCG
GCCACTGCCAAACTGCCGGGCAGCAACTTTTTGACGGAAAATGCCGCTGCTTCCTTCACCGTCAAGCACTTTGCT
GGCGAGGTCGACTACCCGGTCAAAGGACTGATCGAAGAGAACGGCGAAATCATCTCTGTTGACCTGCTGAACATG
TTCAACGCGACCAAGAGCGAGTTTGTCGCCAGGCTCTTTGGGCAAGACGCCCTACAGACCATTTCCCACCCCAAC
GAGAAGACCGCTGTCCTACAGGCCAGCGTTAGCTCAAAGCCCATGCGTGCGCCGAGCGTCATGTCGCGCAAAGGT
GGCCGTGGTAGAGCATTAGCCACTCAGCGTTGGCACCAGGACTCGGCCGAACAGAGGGCCGACAACGCGAAGACT
GTCAAAAACGGCACCTCCAAAGGCCCGACGGAGCAAGGAGCCTCAGGCCAGTTTCTCTCGTCTCTGGACAATGTC
CAGAAAGTGGTGACGGACCCAGGCACAAACGCGTACTTTGTTTTCTGCCTGAAGCCAAATGACCGCCGTATCGCC
AACCAGTTCGACAGCAAGTGCGTGCGTACCCAGGTGCAGACATTTGGCATTGCAGAGATCAGCCAAAGGCTGCGA
TCAGCCGACTTCAGCCTGTTCCTGCCCTTTGGCGAGTTCCTGGGCATGGCTGATGCTGAGACGATCCTCGTCGGC
AGCGAACGAGAACGTGTTGAGATGGTCATAGATGAGAAGCGGTGGCCCAGCAACGAGGTTCAAGTCGGCTCCACG
GGCGTCTTCCTGAGCGAGAGATGCTGGTTGGAAGTTGCACACCTATCCGAGAAAGGAGGCAGTCTCGGACGTTTC
GGCTCGCTCGCCGAGTCCCAGGGCGGCGACGGGCTTCCCGCCGGCGAGCAACACGCCTTTGTTGCCTCCAAGGAG
CAGCTTCTCTCAGCCGGCAACACTCCTCTGATGTATGGGGAGAAGGGCAAGGCTGGCGGCTATTTTACTGGCTCC
GACGACACCCGATCCGAGGCCGGTGTTTCGGCTCTGGGTGCTGGCGACATGTTCAAGAACCTCGATACGCGAGAA
CAGATGGCTGAACGAGGCAACGAGAAGTCTCTCGAGGAGGTCGAGGAATTCAAAGACAGCCCAAGCCGTAAACGA
TGGGTCTTCACTGTCTACTTCCTAACCTGGTTTATCCCCGACTTTCTCATTCGTTGGGTGGGACGCATGCCACGC
AAAGATGTGCGCATGGCCTGGAGAGAAAAGGTTGCGATCAATATGCTCATCTGGTTCCTCTGCCTGGTAGCTGCC
TTTTTCATCGTGGTCTTCCCGATGCTCATTTGCCCCAAGCAAAACGTCTTCAGCGCAGAGGAACTCTCGGCATAT
GACGGCAAGGAGGGCAGCAAAGGTGCGTACGCCTCCATTCGAGGGTACGTCATCGACCTGGGCGCTTATGCGCCG
CGTCATTATCCGAATTATCTGGGTACCAAGAGTCTGTTAAATTACGCGGGCAAAGACATCAGCTCTCTCTTCCCT
CTCCAGGTGTCGGCTTTGTGCCAGGGAGCCACCGGCTCCGTGAATGAGGAAGTCACATTGGACTACAAGAATGTT
AACCTGACGGGCTCTCCAAACCTGATCAATTCGCAGGACATCAACGCTAAGTATCATGATTTCCGCTATTTCACC
AACGACACTAGGCCGGACTGGTACCTGGAGCAGCTGCTGACTCTTCGAGGCAACTGGGGTAAGGGCAATATCGGA
TATTCGCCAGAATATGTGAAGAAGCTTGCTCAGAAGGAGCAGACGATCGCAATCATTGGGAGCAAGGTCTACGAC
TTGACGACGTACGTCCGTGGTGGACTCAAAATGCGAGCCAAGTCAGGGGAAAAGCCACCAAATGACCCGTCGCTC
ATAAACTTCATGGATTCCTCCGTCATGACGCTGTTCCAGCTCAAGGCGGGTGAAGATATCACCAAGTACTGGGAT
TCGTTGGCCATCGGGGGGGATATGAAGAAGAGGATGCAGACGTGCCTCGACTACCTCTTCTACGTTGGCGACGTC
GACACCAGGAACTCGACCCGCTGTCAATTTGCAGAATATCTGGTACTGGCTGTCTCGATCCTCCTCGCCTCGGTG
ATAGCATTCAAGTTCTTCGCCGCGCTGCAGTTCGGCGGCAAAAACGTGCCCGAGAATCTCGACAAGTTTGTTCTT
TGCCAGATCCCGGCTTACACCGAGGACGAGGATTCCCTTCGTCGTGCTATCGACTCTGCCGCCCGGATGCGCTAC
GATGATAAGCGGAAGCTCCTGGTCATCGTCTGCGATGGCATGATTATTGGCCAAGGCAATGACAGACCAACCCCC
CGCATCGTGCTCGATATTCTTGGTGTGTCTGAAACGGTCGATCCCGAGCCTTTGAGCTTCGAATCGCTCGGCGAA
GGCCAGAAGCAACATAACATGGGTAAGGTCTACTCCGGCTTATATGAGGTTCAAGGCCACATTGTACCATTCATG
GTTATCGTCAAGGTTGGCAAGCCGTCCGAGGTTGTCCGCCCAGGAAATCGCGGCAAGCGTGACTCGCAGATGGTC
GTCATGCGTTTTCTCAACCGCGTCCACTATAACCTCTCGATGAGCCCCCTAGAGCTGGAGATGTATCATCAGATT
CGAAACATTATCGGCGTCAACCCGACCTTTTACGAGTTTATGTTGCAAATCGACGCCGATACGGTCGTCGCCCCA
GACTCGGCCACGCGGATGGTCTCGGCCTTCCTCGACGACACGCGCCTGATCGCTGTGTGCGGTGAGACGGCTCTG
ACCAACGCCAAGTCCTCCTTTATTACCATGATCCAGGTTTACGAATACTACATATCTCACAATCTATCCAAAGCC
TTTGAGAGTCTATTTGGGTCCGTTACCTGCTTGCCCGGCTGTTTCTCGATGTACCGCATCCGCGCCGCCGAGACC
GGGAAGCCGCTCTTCGTCAGCCGCGAGGTTGTGGAGTCGTATGCCACAATTCGCGTCGACACGCTGCATATGAAG
AACCTTCTACACCTCGGCGAAGATCGCTATCTCACCACATTGCTCCTCAAGTTTCACTCCAAGTATAAGACCAAA
TATATCTTCACGGCTCACGCCTGGACCATCGCTCCCGACTCTTGGCAGGTCTTTCTCTCGCAGCGGCGTCGTTGG
ATCAACTCTACCGTGCACAACTTGATTGAACTGATTCCCATGAATCAGCTCTGCGGCTTCTGCTGCTTCAGCATG
CGTTTCATCGTCTTCGTCGACTTGCTCAGTACCGTCGTCCAGCCTGTCACGATTGCATATATCGTGTATCTTATC
GTGCTCGTCGCGACAAGGACGACGGTCGTGCCCATCACAGCGTTCGTCTTACTCGGCGTCATCTACGGTCTTCAG
GCCATCATCTTCATCTTGCGCCGCAAGTGGGAAATGGTAGGGTGGATGGTCCTTTACGTCCTGGCTATTCCCGTC
TTCAGCTTCGGCCTGCCCCTGTACGCCTTCTGGCACATGGATGACTTCAACTGGGGCAACACGCGTGTTGTCGCC
GGCGAAAAGGGCAAGAAGGTCGTTATCTCGGACGAGGGCAAGTTCGACCCTGGCTCTATCCCTCGCAAGAAGTGG
GAGGAATACCAGGCGGAGCTCTGGGAGACGCAGACATCACGCGACGACACTCGATCCGAGATTTCCGGCTTCAGT
TACGGCACAAAGGCTCAGGCGCTTGTCTCCGAGTACGCCTTCCCCAGTCGCCCGGACTCGACCACCGGATTCGCA
GCCCATCCTTCCGCGTCTCATCTGCCCCCGTACGACTCACGCAATGTATCGCGCATGTCTCTGGCTGCCTCGGAG
ATGGGCGGCAACCGCATGAGCCACTTCAGCGGATCTCAGTTCTTCAACCCTGACGACATGGTTGGCCTGCCCAGC
GACGATGCCCTCTTGGCCGAGATCCGCGATATTCTCAGGACTGCTGACTTGATGACGGTCACGAAAAAAGGAGTT
AAGCAGGAGCTGGAAAGGCGTTTCGACGTGCCGCTGGACACGAAGCGAGCCTACATCAACAGCGCAACCGAAGCT
ATCCTATCCGGCCAGCTCTGA
Transcript >Hirsu2|10213
ATGGCCGGCGCCGAAGACATGGCTGACCGCGCTTGGTTGAGGCTGGGCCATCGATCCGAGAGCCAGGCCATCGTC
TTCCTCGGTGAGTCTGGGTCTGGCAAGTCGACCGTCCGCAACCATCTCCTTTCGGCGTTGCTCGACAAGTCCTCC
ACACCCCTATCAACGAAGCTCTCTCTGGCCGCCTATGTCTTCGACACCCTCACTACGACCAAGACTGCTACTACG
CCGACGGCCTCCAAGTCCGGCCTCTTCTACGAGCTTCAATACGACACCTCAAGCACGACCAATCCGATCCTCATC
GGCGGCAAGGTGTTGGATCACAGGCTCGAGAGGAGCCGCATTACGGACGTGCCGACCGGTGAGAGGAATTTCCAC
ATCTTGTACTACCTCTTGGCCGGCACCAGTGAGGCCGAGAAGACTCATCTTGGCCTTGACGGGTCAAAGAGATGG
AAATATCTCGGACACCCGACTCAGCTCAAGGTGGGCATTAATGACGCCGAGGGCTTCCAACTTTTCAAGAGTGCC
TTGAGGAAGCTCGAGTTCCCCAGAGGCGAGATCGCGGAGATTTGTCAAGTTCTGGCCACCATTCTCCACATCGGT
CAGCTCGAATTCGAGACAACCAGCAACACCAGCGCCACCGGCGATGACAGCGGCGGCTTCTCCCACGAAGGCGGC
GTCATCACAACGACCGTCAAGAATAAGGACGTCCTCGCCATCATTGCTGCCTTTCTCGGCGTCAGCAACGGCGAC
CTCCAGAACACACTGGGCTACAAGACGAAGATGATACAGAAGGAGCGCGTCACCGTGATGTTGGACCCTAATGGT
GCCCGTGCTCACGCCAACGAGCTGGCCCGCACCCTGTATGCTCTTTTGGTTGCGTGGATCATCGAAAATGCCAAC
CAGAGAGTCTGTGCGCTGGAAGATGGCATCGCCAACACCATTTCCCTGGTCGACTTCCCCGGCTTTGCACAGCAG
TCATCGACCAGATCCACCCTTGACCAGCTCCTGAACAATGCAGCCACCGAGGCAGTGTACAACATGGCGCTGCAC
AATTTCTTTGACCGCAAAGCCGAGATGCTCGAGTCCGAGGAGGTCAGCGTCACCCCCACGAGCTACTTTGACAAT
TCCGACGCCGTCAAAGGCCTGCTCAAGGCTGGAAATGGCCTCCTCAGTATTCTTGATGACCAGACACGGAGAAAC
AGGACGGACATTCAGCTCCTCGAGAGCCTGCGAAAGCGCTTCGAAGGTAAGAATCCGGCGATAGAAGTCAGTTCG
GCCACTGCCAAACTGCCGGGCAGCAACTTTTTGACGGAAAATGCCGCTGCTTCCTTCACCGTCAAGCACTTTGCT
GGCGAGGTCGACTACCCGGTCAAAGGACTGATCGAAGAGAACGGCGAAATCATCTCTGTTGACCTGCTGAACATG
TTCAACGCGACCAAGAGCGAGTTTGTCGCCAGGCTCTTTGGGCAAGACGCCCTACAGACCATTTCCCACCCCAAC
GAGAAGACCGCTGTCCTACAGGCCAGCGTTAGCTCAAAGCCCATGCGTGCGCCGAGCGTCATGTCGCGCAAAGGT
GGCCGTGGTAGAGCATTAGCCACTCAGCGTTGGCACCAGGACTCGGCCGAACAGAGGGCCGACAACGCGAAGACT
GTCAAAAACGGCACCTCCAAAGGCCCGACGGAGCAAGGAGCCTCAGGCCAGTTTCTCTCGTCTCTGGACAATGTC
CAGAAAGTGGTGACGGACCCAGGCACAAACGCGTACTTTGTTTTCTGCCTGAAGCCAAATGACCGCCGTATCGCC
AACCAGTTCGACAGCAAGTGCGTGCGTACCCAGGTGCAGACATTTGGCATTGCAGAGATCAGCCAAAGGCTGCGA
TCAGCCGACTTCAGCCTGTTCCTGCCCTTTGGCGAGTTCCTGGGCATGGCTGATGCTGAGACGATCCTCGTCGGC
AGCGAACGAGAACGTGTTGAGATGGTCATAGATGAGAAGCGGTGGCCCAGCAACGAGGTTCAAGTCGGCTCCACG
GGCGTCTTCCTGAGCGAGAGATGCTGGTTGGAAGTTGCACACCTATCCGAGAAAGGAGGCAGTCTCGGACGTTTC
GGCTCGCTCGCCGAGTCCCAGGGCGGCGACGGGCTTCCCGCCGGCGAGCAACACGCCTTTGTTGCCTCCAAGGAG
CAGCTTCTCTCAGCCGGCAACACTCCTCTGATGTATGGGGAGAAGGGCAAGGCTGGCGGCTATTTTACTGGCTCC
GACGACACCCGATCCGAGGCCGGTGTTTCGGCTCTGGGTGCTGGCGACATGTTCAAGAACCTCGATACGCGAGAA
CAGATGGCTGAACGAGGCAACGAGAAGTCTCTCGAGGAGGTCGAGGAATTCAAAGACAGCCCAAGCCGTAAACGA
TGGGTCTTCACTGTCTACTTCCTAACCTGGTTTATCCCCGACTTTCTCATTCGTTGGGTGGGACGCATGCCACGC
AAAGATGTGCGCATGGCCTGGAGAGAAAAGGTTGCGATCAATATGCTCATCTGGTTCCTCTGCCTGGTAGCTGCC
TTTTTCATCGTGGTCTTCCCGATGCTCATTTGCCCCAAGCAAAACGTCTTCAGCGCAGAGGAACTCTCGGCATAT
GACGGCAAGGAGGGCAGCAAAGGTGCGTACGCCTCCATTCGAGGGTACGTCATCGACCTGGGCGCTTATGCGCCG
CGTCATTATCCGAATTATCTGGGTACCAAGAGTCTGTTAAATTACGCGGGCAAAGACATCAGCTCTCTCTTCCCT
CTCCAGGTGTCGGCTTTGTGCCAGGGAGCCACCGGCTCCGTGAATGAGGAAGTCACATTGGACTACAAGAATGTT
AACCTGACGGGCTCTCCAAACCTGATCAATTCGCAGGACATCAACGCTAAGTATCATGATTTCCGCTATTTCACC
AACGACACTAGGCCGGACTGGTACCTGGAGCAGCTGCTGACTCTTCGAGGCAACTGGGGTAAGGGCAATATCGGA
TATTCGCCAGAATATGTGAAGAAGCTTGCTCAGAAGGAGCAGACGATCGCAATCATTGGGAGCAAGGTCTACGAC
TTGACGACGTACGTCCGTGGTGGACTCAAAATGCGAGCCAAGTCAGGGGAAAAGCCACCAAATGACCCGTCGCTC
ATAAACTTCATGGATTCCTCCGTCATGACGCTGTTCCAGCTCAAGGCGGGTGAAGATATCACCAAGTACTGGGAT
TCGTTGGCCATCGGGGGGGATATGAAGAAGAGGATGCAGACGTGCCTCGACTACCTCTTCTACGTTGGCGACGTC
GACACCAGGAACTCGACCCGCTGTCAATTTGCAGAATATCTGGTACTGGCTGTCTCGATCCTCCTCGCCTCGGTG
ATAGCATTCAAGTTCTTCGCCGCGCTGCAGTTCGGCGGCAAAAACGTGCCCGAGAATCTCGACAAGTTTGTTCTT
TGCCAGATCCCGGCTTACACCGAGGACGAGGATTCCCTTCGTCGTGCTATCGACTCTGCCGCCCGGATGCGCTAC
GATGATAAGCGGAAGCTCCTGGTCATCGTCTGCGATGGCATGATTATTGGCCAAGGCAATGACAGACCAACCCCC
CGCATCGTGCTCGATATTCTTGGTGTGTCTGAAACGGTCGATCCCGAGCCTTTGAGCTTCGAATCGCTCGGCGAA
GGCCAGAAGCAACATAACATGGGTAAGGTCTACTCCGGCTTATATGAGGTTCAAGGCCACATTGTACCATTCATG
GTTATCGTCAAGGTTGGCAAGCCGTCCGAGGTTGTCCGCCCAGGAAATCGCGGCAAGCGTGACTCGCAGATGGTC
GTCATGCGTTTTCTCAACCGCGTCCACTATAACCTCTCGATGAGCCCCCTAGAGCTGGAGATGTATCATCAGATT
CGAAACATTATCGGCGTCAACCCGACCTTTTACGAGTTTATGTTGCAAATCGACGCCGATACGGTCGTCGCCCCA
GACTCGGCCACGCGGATGGTCTCGGCCTTCCTCGACGACACGCGCCTGATCGCTGTGTGCGGTGAGACGGCTCTG
ACCAACGCCAAGTCCTCCTTTATTACCATGATCCAGGTTTACGAATACTACATATCTCACAATCTATCCAAAGCC
TTTGAGAGTCTATTTGGGTCCGTTACCTGCTTGCCCGGCTGTTTCTCGATGTACCGCATCCGCGCCGCCGAGACC
GGGAAGCCGCTCTTCGTCAGCCGCGAGGTTGTGGAGTCGTATGCCACAATTCGCGTCGACACGCTGCATATGAAG
AACCTTCTACACCTCGGCGAAGATCGCTATCTCACCACATTGCTCCTCAAGTTTCACTCCAAGTATAAGACCAAA
TATATCTTCACGGCTCACGCCTGGACCATCGCTCCCGACTCTTGGCAGGTCTTTCTCTCGCAGCGGCGTCGTTGG
ATCAACTCTACCGTGCACAACTTGATTGAACTGATTCCCATGAATCAGCTCTGCGGCTTCTGCTGCTTCAGCATG
CGTTTCATCGTCTTCGTCGACTTGCTCAGTACCGTCGTCCAGCCTGTCACGATTGCATATATCGTGTATCTTATC
GTGCTCGTCGCGACAAGGACGACGGTCGTGCCCATCACAGCGTTCGTCTTACTCGGCGTCATCTACGGTCTTCAG
GCCATCATCTTCATCTTGCGCCGCAAGTGGGAAATGGTAGGGTGGATGGTCCTTTACGTCCTGGCTATTCCCGTC
TTCAGCTTCGGCCTGCCCCTGTACGCCTTCTGGCACATGGATGACTTCAACTGGGGCAACACGCGTGTTGTCGCC
GGCGAAAAGGGCAAGAAGGTCGTTATCTCGGACGAGGGCAAGTTCGACCCTGGCTCTATCCCTCGCAAGAAGTGG
GAGGAATACCAGGCGGAGCTCTGGGAGACGCAGACATCACGCGACGACACTCGATCCGAGATTTCCGGCTTCAGT
TACGGCACAAAGGCTCAGGCGCTTGTCTCCGAGTACGCCTTCCCCAGTCGCCCGGACTCGACCACCGGATTCGCA
GCCCATCCTTCCGCGTCTCATCTGCCCCCGTACGACTCACGCAATGTATCGCGCATGTCTCTGGCTGCCTCGGAG
ATGGGCGGCAACCGCATGAGCCACTTCAGCGGATCTCAGTTCTTCAACCCTGACGACATGGTTGGCCTGCCCAGC
GACGATGCCCTCTTGGCCGAGATCCGCGATATTCTCAGGACTGCTGACTTGATGACGGTCACGAAAAAAGGAGTT
AAGCAGGAGCTGGAAAGGCGTTTCGACGTGCCGCTGGACACGAAGCGAGCCTACATCAACAGCGCAACCGAAGCT
ATCCTATCCGGCCAGCTCTGA
Gene >Hirsu2|10213
ATGGCCGGCGCCGAAGACATGGCTGACCGCGCTTGGTTGAGGCTGGGCCATCGATCCGAGAGCCAGGCCATCGTC
TTCCTGTAAGTACTCTCCTGCTCTGGAGGGCCAAGATTTATTATCAGGCTCTCGTGTCGTCTCACAACTCCATCA
GCGGTGAGTCTGGGTCTGGCAAGTCGACCGTCCGCAACCATCTCCTTTCGGCGTTGCTCGACAAGTCCTCCACAC
CCCTATCAACGAAGCTCTCTCTGGCCGCCTATGTCTTCGACACCCTCACTACGACCAAGACTGCTACTACGCCGA
CGGCCTCCAAGTCCGGCCTCTTCTACGAGCTTCAATACGACACCTCAAGCACGACCAATCCGATCCTCATCGGCG
GCAAGGTGTTGGATCACAGGCTCGAGAGGAGCCGCATTACGGACGTGCCGACCGGTGAGAGGAATTTCCACATCT
TGTACTACCTCTTGGCCGGCACCAGTGAGGCCGAGAAGACTCATCTTGGCCTTGACGGGTCAAAGAGATGGAAAT
ATCTCGGACACCCGACTCAGCTCAAGGTGGGCATTAATGACGCCGAGGGCTTCCAACTTTTCAAGAGTGCCTTGA
GGAAGCTCGAGTTCCCCAGAGGCGAGATCGCGGAGATTTGTCAAGTTCTGGCCACCATTCTCCACATCGGTCAGC
TCGAATTCGAGACAACCAGCAACACCAGCGCCACCGGCGATGACAGCGGCGGCTTCTCCCACGAAGGCGGCGTCA
TCACAACGACCGTCAAGAATAAGGACGTCCTCGCCATCATTGCTGCCTTTCTCGGCGTCAGCAACGGCGACCTCC
AGAACACACTGGGCTACAAGACGAAGATGATACAGAAGGAGCGCGTCACCGTGATGTTGGACCCTAATGGTGCCC
GTGCTCACGCCAACGAGCTGGCCCGCACCCTGTATGCTCTTTTGGTTGCGTGGATCATCGAAAATGCCAACCAGA
GAGTCTGTGCGCTGGAAGATGGCATCGCCAACACCATTTCCCTGGTCGACTTCCCCGGCTTTGCACAGCAGTCAT
CGACCAGATCCACCCTTGACCAGCTCCTGAACAATGCAGCCACCGAGGCAGTGTACAACATGGCGCTGCACAATT
TCTTTGACCGCAAAGCCGAGATGCTCGAGTCCGAGGAGGTCAGCGTCACCCCCACGAGCTACTTTGACAATTCCG
ACGCCGTCAAAGGCCTGCTCAAGGCTGGAAATGGCCTCCTCAGTATTCTTGATGACCAGACACGGAGAAACAGGA
CGGACATTCAGCTCCTCGAGAGCCTGCGAAAGCGCTTCGAAGGTAAGAATCCGGCGATAGAAGTCAGTTCGGCCA
CTGCCAAACTGCCGGGCAGCAACTTTTTGACGGAAAATGCCGCTGCTTCCTTCACCGTCAAGCACTTTGCTGGCG
AGGTCGACTACCCGGTCAAAGGACTGATCGAAGAGAACGGCGAAATCATCTCTGTTGACCTGCTGAACATGTTCA
ACGCGACCAAGAGCGAGTTTGTCGCCAGGCTCTTTGGGCAAGACGCCCTACAGACCATTTCCCACCCCAACGAGA
AGACCGCTGTCCTACAGGCCAGCGTTAGCTCAAAGCCCATGCGTGCGCCGAGCGTCATGTCGCGCAAAGGTGGCC
GTGGTAGAGCATTAGCCACTCAGCGTTGGCACCAGGACTCGGCCGAACAGAGGGCCGACAACGCGAAGACTGTCA
AAAACGGCACCTCCAAAGGCCCGACGGAGCAAGGAGCCTCAGGCCAGTTTCTCTCGTCTCTGGACAATGTCCAGA
AAGTGGTGACGGACCCAGGCACAAACGCGTACTTTGTTTTCTGCCTGAAGCCAAATGACCGCCGTATCGCCAACC
AGTTCGACAGCAAGTGCGTGCGTACCCAGGTGCAGACATTTGGCATTGCAGAGATCAGCCAAAGGCTGCGATCAG
CCGACTTCAGCCTGTTCCTGCCCTTTGGCGAGTTCCTGGGCATGGCTGATGCTGAGACGATCCTCGTCGGCAGCG
AACGAGAACGTGTTGAGATGGTCATAGATGAGAAGCGGTGGCCCAGCAACGAGGTTCAAGTCGGCTCCACGGGCG
TCTTCCTGAGCGAGAGATGCTGGTTGGAAGTTGCACACCTATCCGAGAAAGGAGGCAGTCTCGGACGTTTCGGCT
CGCTCGCCGAGTCCCAGGGCGGCGACGGGCTTCCCGCCGGCGAGCAACACGCCTTTGTTGCCTCCAAGGAGCAGC
TTCTCTCAGCCGGCAACACTCCTCTGATGTATGGGGAGAAGGGCAAGGCTGGCGGCTATTTTACTGGCTCCGACG
ACACCCGATCCGAGGCCGGTGTTTCGGCTCTGGGTGCTGGCGACATGTTCAAGAACCTCGATACGCGAGAACAGA
TGGCTGAACGAGGCAACGAGAAGTCTCTCGAGGAGGTCGAGGAATTCAAAGACAGCCCAAGCCGTAAACGATGGG
TCTTCACTGTCTACTTCCTAACCTGGTTTATCCCCGACTTTCTCATTCGTTGGGTGGGACGCATGCCACGCAAAG
ATGTGCGCATGGCCTGGAGAGAAAAGGTTGCGATCAATATGCTCATCTGGTTCCTCTGCCTGGTAGCTGCCTTTT
TCATCGTGGTCTTCCCGATGCTCATTTGCCCCAAGCAAAACGTCTTCAGCGCAGAGGAACTCTCGGCATATGACG
GCAAGGAGGGCAGCAAAGGTGCGTACGCCTCCATTCGAGGGTACGTCATCGACCTGGGCGCTTATGCGCCGCGTC
ATTATCCGAATTATCTGGGTACCAAGAGTCTGTTAAATTACGCGGGCAAAGACATCAGCTCTCTCTTCCCTCTCC
AGGTGTCGGCTTTGTGCCAGGGAGCCACCGGCTCCGTGAATGAGGAAGTCACATTGGACTACAAGAATGTTAACC
TGACGGGCTCTCCAAACCTGATCAATTCGCAGGACATCAACGCTAAGTATCATGATTTCCGCTATTTCACCAACG
ACACTAGGCCGGACTGGTACCTGGAGCAGCTGCTGACTCTTCGAGGCAACTGGGGTAAGGGCAATATCGGATATT
CGCCAGAATATGTGAAGAAGCTTGCTCAGAAGGAGCAGACGATCGCAATCATTGGGAGCAAGGTCTACGACTTGA
CGACGTACGTCCGTGGTGGACTCAAAATGCGAGCCAAGTCAGGGGAAAAGCCACCAAATGACCCGTCGCTCATAA
ACTTCATGGATTCCTCCGTCATGACGCTGTTCCAGCTCAAGGCGGGTGAAGATATCACCAAGTACTGGGATTCGT
TGGCCATCGGGGGGGATATGAAGAAGAGGATGCAGACGTGCCTCGACTACCTCTTCTACGTTGGCGACGTCGACA
CCAGGAACTCGACCCGCTGTCAATTTGCAGAATATCTGGTACTGGCTGTCTCGATCCTCCTCGCCTCGGTGATAG
CATTCAAGTTCTTCGCCGCGCTGCAGTTCGGCGGCAAAAACGTGCCCGAGAATCTCGACAAGTTTGTTCTTTGCC
AGATCCCGGCTTACACCGAGGACGAGGATTCCCTTCGTCGTGCTATCGACTCTGCCGCCCGGATGCGCTACGATG
ATAAGCGGAAGCTCCTGGTCATCGTCTGCGATGGCATGATTATTGGCCAAGGCAATGACAGACCAACCCCCCGCA
TCGTGCTCGATATTCTTGGTGTGTCTGAAACGGTCGATCCCGAGCCTTTGAGCTTCGAATCGCTCGGCGAAGGCC
AGAAGCAACATAACATGGGTAAGGTCTACTCCGGCTTATATGAGGTTCAAGGCCACATTGTACCATTCATGGTTA
TCGTCAAGGTTGGCAAGCCGTCCGAGGTTGTCCGCCCAGGAAATCGCGGCAAGCGTGACTCGCAGATGGTCGTCA
TGCGTTTTCTCAACCGCGTCCACTATAACCTCTCGATGAGCCCCCTAGAGCTGGAGATGTATCATCAGATTCGAA
ACATTATCGGCGTCAACCCGACCTTTTACGAGTTTATGTTGCAAATCGACGCCGATACGGTCGTCGCCCCAGACT
CGGCCACGCGGATGGTCTCGGCCTTCCTCGACGACACGCGCCTGATCGCTGTGTGCGGTGAGACGGCTCTGACCA
ACGCCAAGTCCTCCTTTATTACCATGATCCAGGTTTACGAATACTACATATCTCACAATCTATCCAAAGCCTTTG
AGAGTCTATTTGGGTCCGTTACCTGCTTGCCCGGCTGTTTCTCGATGTACCGCATCCGCGCCGCCGAGACCGGGA
AGCCGCTCTTCGTCAGCCGCGAGGTTGTGGAGTCGTATGCCACAATTCGCGTCGACACGCTGCATATGAAGAACC
TTCTACACCTCGGCGAAGATCGCTATCTCACCACATTGCTCCTCAAGTTTCACTCCAAGTATAAGACCAAATATA
TCTTCACGGCTCACGCCTGGACCATCGCTCCCGACTCTTGGCAGGTCTTTCTCTCGCAGCGGCGTCGTTGGATCA
ACTCTACCGTGCACAACTTGATTGAACTGATTCCCATGAATCAGCTCTGCGGCTTCTGCTGCTTCAGCATGCGTT
TCATCGTCTTCGTCGACTTGCTCAGTACCGTCGTCCAGCCTGTCACGATTGCATATATCGTGTATCTTATCGTGC
TCGTCGCGACAAGGACGACGGTCGTGCCCATCACAGCGTTCGTCTTACTCGGCGTCATCTACGGTCTTCAGGCCA
TCATCTTCATCTTGCGCCGCAAGTGGGAAATGGTAGGGTGGATGGTCCTTTACGTCCTGGCTATTCCCGTCTTCA
GCTTCGGCCTGCCCCTGTACGCCTTCTGGCACATGGATGACTTCAACTGGGGCAACACGCGTGTTGTCGCCGGCG
AAAAGGGCAAGAAGGTCGTTATCTCGGACGAGGGCAAGTTCGACCCTGGCTCTATCCCTCGCAAGAAGTGGGAGG
AATACCAGGCGGAGCTCTGGGAGACGCAGACATCACGCGACGACACTCGATCCGAGATTTCCGGCTTCAGTTACG
GCACAAAGGCTCAGGCGCTTGTCTCCGAGTACGCCTTCCCCAGTCGCCCGGACTCGACCACCGGATTCGCAGCCC
ATCCTTCCGCGTCTCATCTGCCCCCGTACGACTCACGCAATGTATCGCGCATGTCTCTGGCTGCCTCGGAGATGG
GCGGCAACCGCATGAGCCACTTCAGCGGATCTCAGTTCTTCAACCCTGACGACATGGTTGGCCTGCCCAGCGACG
ATGCCCTCTTGGCCGAGATCCGCGATATTCTCAGGACTGCTGACTTGATGACGGTCACGAAAAAAGGAGTTAAGC
AGGAGCTGGAAAGGCGTTTCGACGTGCCGCTGGACACGAAGCGAGCCTACATCAACAGCGGTATGTAGCCCCTTC
CTTTTTGAGACCTGCGTTCTCGCTCAGACAAGACATGCTGACCCAAAACGGGCAGCAACCGAAGCTATCCTATCC
GGCCAGCTCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail