Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10211
Gene name
LocationContig_802:1658..2308
Strand+
Gene length (bp)650
Transcript length (bp)576
Coding sequence length (bp)576
Protein length (aa) 192

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11707 Npa1 Ribosome 60S biogenesis N-terminal 4.1E-41 2 173

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.503 0.5123 0.3742 0.0742 0.278 0.0238 0.1366 0.1673 0.2284 0.0162

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1143
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6771
Ophiocordyceps australis map64 (Brazil) OphauB2|7315
Ophiocordyceps camponoti-floridani Ophcf2|04234
Ophiocordyceps camponoti-rufipedis Ophun1|1503
Ophiocordyceps kimflemingae Ophio5|2398
Ophiocordyceps subramaniannii Hirsu2|10211 (this protein)
Ophiocordyceps subramaniannii Hirsu2|10212

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10211
MLEILDSLRLYVLMDSKIPREIKSRSFNTKTLMRFLTLYKTAGTSADPAEKDVVSERVDQFLKYICTAPSAGVLY
PYKGLYPKNAEDAYSDYPPKGRGECDGDGVRGDWSDKEFSVFNFVLCEFAEKLRPGSNPKHSELLVSIFTAAPEL
IARYFHDNRTFVFEPKLSSTWIGGPSAHIHSAGQHFAPRYQ*
Coding >Hirsu2|10211
ATGCTGGAGATCCTAGACTCCCTCAGGCTCTATGTCCTCATGGATAGCAAGATACCCAGAGAAATCAAGTCTCGG
AGCTTCAACACCAAGACGCTCATGAGATTTTTAACCCTCTACAAGACGGCTGGCACCTCTGCGGACCCTGCTGAG
AAAGACGTCGTGAGCGAGAGGGTCGACCAATTTCTCAAGTATATATGCACGGCGCCTAGTGCCGGCGTGCTTTAT
CCCTACAAGGGACTCTACCCCAAGAACGCAGAGGACGCATACTCTGATTATCCACCCAAGGGGCGCGGCGAGTGC
GACGGCGACGGGGTACGAGGCGATTGGTCCGACAAGGAATTTTCCGTCTTCAACTTCGTCCTGTGCGAGTTCGCT
GAAAAGCTGCGTCCAGGATCCAATCCGAAGCATAGCGAGCTGCTCGTGTCCATCTTCACGGCCGCCCCCGAACTG
ATAGCCAGGTACTTCCATGATAACCGAACCTTTGTTTTCGAGCCCAAGCTTTCCTCGACATGGATTGGAGGGCCC
TCCGCCCACATCCATTCTGCTGGACAACATTTTGCCCCCCGCTATCAATGA
Transcript >Hirsu2|10211
ATGCTGGAGATCCTAGACTCCCTCAGGCTCTATGTCCTCATGGATAGCAAGATACCCAGAGAAATCAAGTCTCGG
AGCTTCAACACCAAGACGCTCATGAGATTTTTAACCCTCTACAAGACGGCTGGCACCTCTGCGGACCCTGCTGAG
AAAGACGTCGTGAGCGAGAGGGTCGACCAATTTCTCAAGTATATATGCACGGCGCCTAGTGCCGGCGTGCTTTAT
CCCTACAAGGGACTCTACCCCAAGAACGCAGAGGACGCATACTCTGATTATCCACCCAAGGGGCGCGGCGAGTGC
GACGGCGACGGGGTACGAGGCGATTGGTCCGACAAGGAATTTTCCGTCTTCAACTTCGTCCTGTGCGAGTTCGCT
GAAAAGCTGCGTCCAGGATCCAATCCGAAGCATAGCGAGCTGCTCGTGTCCATCTTCACGGCCGCCCCCGAACTG
ATAGCCAGGTACTTCCATGATAACCGAACCTTTGTTTTCGAGCCCAAGCTTTCCTCGACATGGATTGGAGGGCCC
TCCGCCCACATCCATTCTGCTGGACAACATTTTGCCCCCCGCTATCAATGA
Gene >Hirsu2|10211
ATGCTGGAGATCCTAGACTCCCTCAGGCTCTATGTCCTCATGGATAGCAAGATACCCAGAGAAATCAAGTCTCGG
AGCTTCAACACCAAGACGCTCATGAGATTTTTAACCCTCTACAAGACGGCTGGCACCTCTGCGGACCCTGCTGAG
AAAGACGTCGTGAGCGAGAGGGTCGACCAATTTCTCAAGTATATATGCACGGCGCCTAGTGCCGGCGTGCTTTAT
CCCTACAAGGGACTCTACCCCAAGAACGCAGAGGACGCATACTCTGATTATCCACCCAAGGGGCGCGGCGAGTGC
GACGGCGACGGGGTACGAGGCGATTGGTCCGACAAGGAATTTTCCGTCTTCAACTTCGTCCTGTGCGAGTTCGCT
GAAAAGCTGCGTCCAGGATCCAATCCGAAGCATAGCGAGCTGCTCGTGTCCATCTTCACGGCCGCCCCCGAACTG
ATAGCCAGGTACTTCCATGATAACCGAACCTTTGTTTTCGAGCCCAAGCTTTCCTCGACATGGATTGGGTATGCG
GCTTTTCTATTCAACACAATCAGCATACCGCTTCCCCCCGACTTCGGAGATCCGGTACGGTGTGCAGAGGGCCCT
CCGCCCACATCCATTCTGCTGGACAACATTTTGCCCCCCGCTATCAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail