Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1021
Gene name
LocationContig_121:29632..32322
Strand-
Gene length (bp)2690
Transcript length (bp)2610
Coding sequence length (bp)2610
Protein length (aa) 870

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12341 Mcl1_mid Minichromosome loss protein, Mcl1, middle region 4.8E-96 416 705
PF00400 WD40 WD domain, G-beta repeat 2.1E-01 132 167
PF00400 WD40 WD domain, G-beta repeat 6.7E-09 225 261
PF12894 ANAPC4_WD40 Anaphase-promoting complex subunit 4 WD40 domain 3.1E-05 232 275
PF08662 eIF2A Eukaryotic translation initiation factor eIF2A 6.7E-05 196 294

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C107|MCL1_SCHPO Minichromosome loss protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mcl1 PE=1 SV=1 8 852 0.0E+00
sp|Q01454|CTF4_YEAST DNA polymerase alpha-binding protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CTF4 PE=1 SV=2 18 859 4.0E-54
sp|O13046|WDHD1_XENLA WD repeat and HMG-box DNA-binding protein 1 OS=Xenopus laevis GN=wdhd1 PE=1 SV=1 12 867 3.0E-53
sp|P59328|WDHD1_MOUSE WD repeat and HMG-box DNA-binding protein 1 OS=Mus musculus GN=Wdhd1 PE=1 SV=2 1 852 6.0E-47
sp|O75717|WDHD1_HUMAN WD repeat and HMG-box DNA-binding protein 1 OS=Homo sapiens GN=WDHD1 PE=1 SV=1 6 298 4.0E-26
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C107|MCL1_SCHPO Minichromosome loss protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mcl1 PE=1 SV=1 8 852 0.0E+00
sp|Q01454|CTF4_YEAST DNA polymerase alpha-binding protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CTF4 PE=1 SV=2 18 859 4.0E-54
sp|O13046|WDHD1_XENLA WD repeat and HMG-box DNA-binding protein 1 OS=Xenopus laevis GN=wdhd1 PE=1 SV=1 12 867 3.0E-53
sp|P59328|WDHD1_MOUSE WD repeat and HMG-box DNA-binding protein 1 OS=Mus musculus GN=Wdhd1 PE=1 SV=2 1 852 6.0E-47
sp|O75717|WDHD1_HUMAN WD repeat and HMG-box DNA-binding protein 1 OS=Homo sapiens GN=WDHD1 PE=1 SV=1 6 298 4.0E-26
sp|O75717|WDHD1_HUMAN WD repeat and HMG-box DNA-binding protein 1 OS=Homo sapiens GN=WDHD1 PE=1 SV=1 418 863 2.0E-23
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 14 301 3.0E-13
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 14 301 2.0E-12
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 14 301 9.0E-12
sp|B4LJT7|CIAO1_DROVI Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila virilis GN=Ciao1 PE=3 SV=1 187 330 1.0E-10
sp|Q6P0D9|CIAO1_DANRE Probable cytosolic iron-sulfur protein assembly protein ciao1 OS=Danio rerio GN=ciao1 PE=2 SV=1 145 303 1.0E-10
sp|B4JW81|CIAO1_DROGR Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila grimshawi GN=Ciao1 PE=3 SV=1 187 318 1.0E-10
sp|B4KTK4|CIAO1_DROMO Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila mojavensis GN=Ciao1 PE=3 SV=1 187 330 1.0E-10
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 71 302 2.0E-10
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 8 301 2.0E-10
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 17 302 3.0E-10
sp|Q7T0P4|POC1A_XENLA POC1 centriolar protein homolog A OS=Xenopus laevis GN=poc1a PE=1 SV=2 14 264 4.0E-10
sp|P49695|PKWA_THECU Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 15 266 5.0E-10
sp|Q7PS24|CIAO1_ANOGA Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Anopheles gambiae GN=Ciao1 PE=3 SV=3 183 308 5.0E-10
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 14 301 9.0E-10
sp|A8IZG4|CIAO1_CHLRE Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Chlamydomonas reinhardtii GN=CHLREDRAFT_130093 PE=3 SV=1 133 302 9.0E-10
sp|Q6NLV4|FY_ARATH Flowering time control protein FY OS=Arabidopsis thaliana GN=FY PE=1 SV=1 20 295 9.0E-10
sp|B5X212|CIO1B_SALSA Probable cytosolic iron-sulfur protein assembly protein ciao1-B OS=Salmo salar GN=ciao1b PE=2 SV=1 145 303 9.0E-10
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 2 324 1.0E-09
sp|P49695|PKWA_THECU Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 70 301 1.0E-09
sp|P74442|Y143_SYNY3 Uncharacterized WD repeat-containing protein slr0143 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0143 PE=3 SV=1 101 302 1.0E-09
sp|Q8C092|TAF5_MOUSE Transcription initiation factor TFIID subunit 5 OS=Mus musculus GN=Taf5 PE=1 SV=1 74 301 2.0E-09
sp|D3ZW91|POC1B_RAT POC1 centriolar protein homolog B OS=Rattus norvegicus GN=Poc1b PE=3 SV=1 15 271 2.0E-09
sp|B6K1G6|CFD1_SCHJY Probable cytosolic Fe-S cluster assembly factor SJAG_02895 OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=SJAG_02895 PE=3 SV=2 124 319 2.0E-09
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 2 270 3.0E-09
sp|Q292E8|CIAO1_DROPS Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila pseudoobscura pseudoobscura GN=Ciao1 PE=3 SV=1 187 318 3.0E-09
sp|B4GDM7|CIAO1_DROPE Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila persimilis GN=Ciao1 PE=3 SV=2 187 318 3.0E-09
sp|B5X9P2|CIO1A_SALSA Probable cytosolic iron-sulfur protein assembly protein ciao1-A OS=Salmo salar GN=ciao1a PE=2 SV=1 197 301 3.0E-09
sp|Q6FJ73|CIAO1_CANGA Probable cytosolic iron-sulfur protein assembly protein 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CIA1 PE=3 SV=1 134 317 3.0E-09
sp|B4MY77|CIAO1_DROWI Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila willistoni GN=Ciao1 PE=3 SV=1 187 330 3.0E-09
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 14 301 4.0E-09
sp|Q15542|TAF5_HUMAN Transcription initiation factor TFIID subunit 5 OS=Homo sapiens GN=TAF5 PE=1 SV=3 74 301 4.0E-09
sp|B3MC74|CIAO1_DROAN Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila ananassae GN=Ciao1 PE=3 SV=1 187 318 4.0E-09
sp|Q28I85|POC1A_XENTR POC1 centriolar protein homolog A OS=Xenopus tropicalis GN=poc1a PE=2 SV=1 14 267 5.0E-09
sp|B5X9P2|CIO1A_SALSA Probable cytosolic iron-sulfur protein assembly protein ciao1-A OS=Salmo salar GN=ciao1a PE=2 SV=1 145 303 8.0E-09
sp|Q6CBI8|CIAO1_YARLI Probable cytosolic iron-sulfur protein assembly protein 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CIA1 PE=3 SV=1 133 301 8.0E-09
sp|Q17GR9|CIAO1_AEDAE Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Aedes aegypti GN=Ciao1 PE=3 SV=1 183 318 8.0E-09
sp|Q8BHD1|POC1B_MOUSE POC1 centriolar protein homolog B OS=Mus musculus GN=Poc1b PE=2 SV=1 15 263 9.0E-09
sp|Q55DA2|CIAO1_DICDI Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Dictyostelium discoideum GN=ciao1 PE=3 SV=1 145 304 1.0E-08
sp|B4P7Q3|CIAO1_DROYA Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila yakuba GN=Ciao1 PE=3 SV=1 187 330 1.0E-08
sp|Q23256|WDR53_CAEEL WD repeat-containing protein wdr-5.3 OS=Caenorhabditis elegans GN=wdr-5.3 PE=3 SV=1 70 319 1.0E-08
sp|Q5M7T1|CIAO1_RAT Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Rattus norvegicus GN=Ciao1 PE=2 SV=1 139 306 2.0E-08
sp|B3NQR5|CIAO1_DROER Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila erecta GN=Ciao1 PE=3 SV=1 187 330 2.0E-08
sp|Q8TC44|POC1B_HUMAN POC1 centriolar protein homolog B OS=Homo sapiens GN=POC1B PE=1 SV=1 14 274 2.0E-08
sp|Q7K1Y4|CIAO1_DROME Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila melanogaster GN=Ciao1 PE=1 SV=1 187 318 2.0E-08
sp|B4QFZ8|CIAO1_DROSI Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila simulans GN=Ciao1 PE=3 SV=1 187 318 2.0E-08
sp|O76734|TUP1_DICDI General transcriptional corepressor tupA OS=Dictyostelium discoideum GN=tupA PE=2 SV=1 24 297 2.0E-08
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 14 270 3.0E-08
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 14 302 3.0E-08
sp|A8IZG4|CIAO1_CHLRE Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Chlamydomonas reinhardtii GN=CHLREDRAFT_130093 PE=3 SV=1 184 309 3.0E-08
sp|B4HRQ6|CIAO1_DROSE Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila sechellia GN=Ciao1 PE=3 SV=1 187 318 3.0E-08
sp|O76071|CIAO1_HUMAN Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Homo sapiens GN=CIAO1 PE=1 SV=1 139 306 3.0E-08
sp|B6K1G6|CFD1_SCHJY Probable cytosolic Fe-S cluster assembly factor SJAG_02895 OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=SJAG_02895 PE=3 SV=2 81 310 4.0E-08
sp|Q32PJ6|CIAO1_BOVIN Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Bos taurus GN=CIAO1 PE=2 SV=1 139 306 4.0E-08
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 14 301 5.0E-08
sp|Q55DA2|CIAO1_DICDI Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Dictyostelium discoideum GN=ciao1 PE=3 SV=1 133 301 5.0E-08
sp|Q9M2Z2|WDR5A_ARATH COMPASS-like H3K4 histone methylase component WDR5A OS=Arabidopsis thaliana GN=WDR5A PE=1 SV=1 14 302 7.0E-08
sp|Q0CQ54|HIR1_ASPTN Protein hir1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=hir1 PE=3 SV=1 22 299 7.0E-08
sp|Q99KN2|CIAO1_MOUSE Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Mus musculus GN=Ciao1 PE=1 SV=1 139 306 7.0E-08
sp|Q9UT57|CFD1_SCHPO Probable cytosolic Fe-S cluster assembly factor SPAC806.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC806.02c PE=3 SV=1 146 303 8.0E-08
sp|Q5RD06|POC1B_PONAB POC1 centriolar protein homolog B OS=Pongo abelii GN=POC1B PE=2 SV=1 14 263 1.0E-07
sp|Q5DFU0|CIAO1_SCHJA Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Schistosoma japonicum PE=2 SV=1 232 307 1.0E-07
sp|F6ZT52|POC1B_XENTR POC1 centriolar protein homolog B OS=Xenopus tropicalis GN=poc1b PE=2 SV=1 8 264 1.0E-07
sp|Q7T0P4|POC1A_XENLA POC1 centriolar protein homolog A OS=Xenopus laevis GN=poc1a PE=1 SV=2 146 301 2.0E-07
sp|Q9QXE7|TBL1X_MOUSE F-box-like/WD repeat-containing protein TBL1X OS=Mus musculus GN=Tbl1x PE=1 SV=2 105 300 2.0E-07
sp|Q4IBR4|HIR1_GIBZE Protein HIR1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=HIR1 PE=3 SV=1 22 300 2.0E-07
sp|Q0USG2|CIAO1_PHANO Probable cytosolic iron-sulfur protein assembly protein 1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=CIA1 PE=3 SV=1 150 301 2.0E-07
sp|B0XAF3|CIAO1_CULQU Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Culex quinquefasciatus GN=Ciao1 PE=3 SV=1 188 307 2.0E-07
sp|Q17GR9|CIAO1_AEDAE Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Aedes aegypti GN=Ciao1 PE=3 SV=1 133 307 3.0E-07
sp|Q05583|CIAO1_YEAST Cytosolic iron-sulfur protein assembly protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CIA1 PE=1 SV=1 130 307 3.0E-07
sp|Q2TBP4|POC1A_BOVIN POC1 centriolar protein homolog A OS=Bos taurus GN=POC1A PE=2 SV=1 14 264 3.0E-07
sp|A7RWD2|CIAO1_NEMVE Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Nematostella vectensis GN=v1g226592 PE=3 SV=1 187 330 3.0E-07
sp|A6ZYM0|CIAO1_YEAS7 Probable cytosolic iron-sulfur protein assembly protein 1 OS=Saccharomyces cerevisiae (strain YJM789) GN=CIA1 PE=3 SV=1 130 307 3.0E-07
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 10 301 4.0E-07
sp|P49695|PKWA_THECU Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 123 289 4.0E-07
sp|Q32PJ6|CIAO1_BOVIN Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Bos taurus GN=CIAO1 PE=2 SV=1 146 301 5.0E-07
sp|Q32PJ6|CIAO1_BOVIN Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Bos taurus GN=CIAO1 PE=2 SV=1 197 318 5.0E-07
sp|Q99KN2|CIAO1_MOUSE Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Mus musculus GN=Ciao1 PE=1 SV=1 197 318 5.0E-07
sp|O88342|WDR1_MOUSE WD repeat-containing protein 1 OS=Mus musculus GN=Wdr1 PE=1 SV=3 146 298 5.0E-07
sp|D3ZW91|POC1B_RAT POC1 centriolar protein homolog B OS=Rattus norvegicus GN=Poc1b PE=3 SV=1 136 320 6.0E-07
sp|Q5M7T1|CIAO1_RAT Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Rattus norvegicus GN=Ciao1 PE=2 SV=1 197 318 6.0E-07
sp|Q6S7B0|TAF5_ARATH Transcription initiation factor TFIID subunit 5 OS=Arabidopsis thaliana GN=TAF5 PE=1 SV=1 136 301 6.0E-07
sp|O61585|KTNB1_STRPU Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1 71 295 6.0E-07
sp|Q9BQ87|TBL1Y_HUMAN F-box-like/WD repeat-containing protein TBL1Y OS=Homo sapiens GN=TBL1Y PE=2 SV=1 105 300 6.0E-07
sp|Q54KL5|WDR5_DICDI WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1 186 324 6.0E-07
sp|Q9CAA0|COB21_ARATH Coatomer subunit beta'-1 OS=Arabidopsis thaliana GN=At1g79990 PE=2 SV=2 78 301 7.0E-07
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 14 301 8.0E-07
sp|Q99KN2|CIAO1_MOUSE Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Mus musculus GN=Ciao1 PE=1 SV=1 146 303 8.0E-07
sp|Q5M7T1|CIAO1_RAT Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Rattus norvegicus GN=Ciao1 PE=2 SV=1 146 303 9.0E-07
sp|B7QKS1|CIAO1_IXOSC Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Ixodes scapularis GN=ISCW023049 PE=3 SV=1 130 307 9.0E-07
sp|Q6H8D6|COB23_ORYSJ Putative coatomer subunit beta'-3 OS=Oryza sativa subsp. japonica GN=Os02g0209000 PE=3 SV=2 78 301 9.0E-07
sp|O76071|CIAO1_HUMAN Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Homo sapiens GN=CIAO1 PE=1 SV=1 197 318 1.0E-06
sp|Q5DFU0|CIAO1_SCHJA Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Schistosoma japonicum PE=2 SV=1 139 302 1.0E-06
sp|A3LVM1|CIAO1_PICST Probable cytosolic iron-sulfur protein assembly protein 1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=CIA1 PE=3 SV=2 130 307 1.0E-06
sp|Q7RZI0|HIR1_NEUCR Protein hir-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hir-1 PE=3 SV=2 22 299 1.0E-06
sp|Q8NBT0|POC1A_HUMAN POC1 centriolar protein homolog A OS=Homo sapiens GN=POC1A PE=1 SV=2 14 264 1.0E-06
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 14 316 2.0E-06
sp|Q28I85|POC1A_XENTR POC1 centriolar protein homolog A OS=Xenopus tropicalis GN=poc1a PE=2 SV=1 146 301 2.0E-06
sp|Q8TC44|POC1B_HUMAN POC1 centriolar protein homolog B OS=Homo sapiens GN=POC1B PE=1 SV=1 101 320 2.0E-06
sp|O76071|CIAO1_HUMAN Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Homo sapiens GN=CIAO1 PE=1 SV=1 146 301 2.0E-06
sp|B0XAF3|CIAO1_CULQU Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Culex quinquefasciatus GN=Ciao1 PE=3 SV=1 183 318 2.0E-06
sp|Q2GSJ9|HIR1_CHAGB Protein HIR1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=HIR1 PE=3 SV=1 22 299 2.0E-06
sp|Q4V7Z1|POC1B_XENLA POC1 centriolar protein homolog B OS=Xenopus laevis GN=poc1b PE=1 SV=1 8 264 2.0E-06
sp|Q9SJW6|ARC1B_ARATH Actin-related protein 2/3 complex subunit 1B OS=Arabidopsis thaliana GN=ARPC1B PE=2 SV=1 197 319 2.0E-06
sp|Q9VU65|POC1_DROME POC1 centriolar protein homolog OS=Drosophila melanogaster GN=Poc1 PE=2 SV=1 15 305 2.0E-06
sp|O80856|ARC1A_ARATH Actin-related protein 2/3 complex subunit 1A OS=Arabidopsis thaliana GN=ARPC1A PE=2 SV=1 197 319 2.0E-06
sp|Q5VQ78|COB21_ORYSJ Coatomer subunit beta'-1 OS=Oryza sativa subsp. japonica GN=Os06g0143900 PE=2 SV=1 78 301 2.0E-06
sp|Q2UBU2|HIR1_ASPOR Protein HIR1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=HIR1 PE=3 SV=1 22 299 2.0E-06
sp|Q7RY68|PFS2_NEUCR Polyadenylation factor subunit 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=paa-1 PE=3 SV=2 71 301 2.0E-06
sp|Q8QFR2|HIRA_XENLA Protein HIRA OS=Xenopus laevis GN=hira PE=1 SV=2 200 316 2.0E-06
sp|B4JW81|CIAO1_DROGR Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila grimshawi GN=Ciao1 PE=3 SV=1 188 307 3.0E-06
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 22 266 3.0E-06
sp|Q6H8D5|COB22_ORYSJ Coatomer subunit beta'-2 OS=Oryza sativa subsp. japonica GN=Os02g0209100 PE=2 SV=1 78 301 3.0E-06
sp|A2CEH0|POC1B_DANRE POC1 centriolar protein homolog B OS=Danio rerio GN=poc1b PE=2 SV=1 14 271 3.0E-06
sp|Q8JZX3|POC1A_MOUSE POC1 centriolar protein homolog A OS=Mus musculus GN=Poc1a PE=2 SV=2 14 264 3.0E-06
sp|A2QPW4|CIAO1_ASPNC Probable cytosolic iron-sulfur protein assembly protein 1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=cia1 PE=3 SV=1 229 352 3.0E-06
sp|P54686|AIP1_DICDI Actin-interacting protein 1 OS=Dictyostelium discoideum GN=aip1 PE=1 SV=2 58 302 3.0E-06
sp|Q2TBP4|POC1A_BOVIN POC1 centriolar protein homolog A OS=Bos taurus GN=POC1A PE=2 SV=1 101 301 4.0E-06
sp|P79987|HIRA_CHICK Protein HIRA OS=Gallus gallus GN=HIRA PE=1 SV=2 200 316 4.0E-06
sp|Q9BZK7|TBL1R_HUMAN F-box-like/WD repeat-containing protein TBL1XR1 OS=Homo sapiens GN=TBL1XR1 PE=1 SV=1 105 300 4.0E-06
sp|Q8BHJ5|TBL1R_MOUSE F-box-like/WD repeat-containing protein TBL1XR1 OS=Mus musculus GN=Tbl1xr1 PE=1 SV=1 105 300 4.0E-06
sp|Q55DA2|CIAO1_DICDI Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Dictyostelium discoideum GN=ciao1 PE=3 SV=1 183 301 5.0E-06
sp|Q9UUG8|TUP12_SCHPO Transcriptional repressor tup12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup12 PE=1 SV=2 22 261 5.0E-06
sp|O60907|TBL1X_HUMAN F-box-like/WD repeat-containing protein TBL1X OS=Homo sapiens GN=TBL1X PE=1 SV=3 105 300 6.0E-06
sp|Q9LXN4|HIRA_ARATH Protein HIRA OS=Arabidopsis thaliana GN=HIRA PE=1 SV=2 232 301 6.0E-06
sp|Q4R8H1|TBL1X_MACFA F-box-like/WD repeat-containing protein TBL1X OS=Macaca fascicularis GN=TBL1X PE=2 SV=1 105 300 7.0E-06
sp|Q5RKI0|WDR1_RAT WD repeat-containing protein 1 OS=Rattus norvegicus GN=Wdr1 PE=1 SV=3 123 298 7.0E-06
sp|C4Q0P6|LIS1_SCHMA Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1 136 302 7.0E-06
sp|Q7ZVF0|POC1A_DANRE POC1 centriolar protein homolog A OS=Danio rerio GN=poc1a PE=2 SV=1 15 268 7.0E-06
sp|B4KTK4|CIAO1_DROMO Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila mojavensis GN=Ciao1 PE=3 SV=1 136 308 8.0E-06
sp|Q5RD06|POC1B_PONAB POC1 centriolar protein homolog B OS=Pongo abelii GN=POC1B PE=2 SV=1 101 320 8.0E-06
sp|Q7SZM9|TB1RA_XENLA F-box-like/WD repeat-containing protein TBL1XR1-A OS=Xenopus laevis GN=tbl1xr1-a PE=1 SV=1 105 300 8.0E-06
sp|Q6GPC6|TB1RB_XENLA F-box-like/WD repeat-containing protein TBL1XR1-B OS=Xenopus laevis GN=tbl1xr1-b PE=2 SV=1 105 300 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1021
MDSTTAPRPRPRPAHTQGTTRCAYTVDGSRLVTVGSNNTIRLYKTGSDGEPTNIDDCQEQNVSISVGLDFFVVGS
EDGTVSLYSLSATTFERFLLRTSLPIREVALSSDWEWCAVASDELSVKIVHTTDITQVKHLREHGRPARHVSFDP
NATLAAVSCTDGIVYVYSLTADEPELIRKVDGIIGALEGESDTSTRVAWHPDGRAFAVPTPTRDIQVVSKHDWEK
QRCFANGHLADITCLAWSPNGAMLASASKDGKILIWETKTQSVIQRYHYSNVVDVAWHPSGNTLSFTTTDGEVFI
YSDFLPDQFAPMLKLHRQPAPFIHDPLSEVSGNRRPPQNNGRKGHDIPSRARRESFGSLDSLLGGVDDVDEDNFV
DDDDGAGYAVGAGSKRGRDGDDLSGEHASKRISLARPLHHEAFQSGSTPWRGNRKYLCLNLIGFVWTVDQDSHYT
VTVEFYDHEFQRDFHFTDTFLYDKACLNEHGTLFSCPPKDDAPAYIFYRPHESWTQRSDWRTELPQGEAVMAMSL
SESFVTITTSASYVRVFTLFGMPYRVYRPKSTPMVTCASWRDYVLTIGNGPVGADGRTRLQYTIENVKRDEICQN
EDTVALPEGVTLAGVFFSDQGDPCIYDSTGTLLTLLHWRQPSRASWVPLLDTKLLPRLASGRKHETYFPVAVADH
KFHCIILKGGDRYPYFPRPLLSDFEFSIPLASRRKKEARKRKGAGDGEDERMAGEGEEEREEEEEKDDDDDDEDD
GRAERRKLEQQFLLKGVQAAQLRDVVDATASSHTHRSLLSRIELDIDKVLLQLLAVECREGEDRGMRALEMVELM
RDRTGRMMEAAGKVAERYGRTVLGEKIREIGEKRVGRMAEDEDF*
Coding >Hirsu2|1021
ATGGACTCAACAACAGCACCCCGGCCGCGCCCTCGGCCAGCACACACGCAGGGCACTACGCGCTGCGCCTACACG
GTCGACGGCTCGCGACTCGTCACAGTCGGCTCCAACAACACTATTCGCCTGTACAAGACGGGCTCCGACGGCGAA
CCCACGAACATCGACGACTGCCAGGAACAGAATGTCTCCATTTCCGTCGGTCTTGACTTCTTCGTCGTCGGATCC
GAGGACGGGACCGTCAGCCTCTACTCCCTCAGCGCCACCACTTTTGAGCGATTCCTGCTGCGCACGTCGCTGCCG
ATCCGAGAAGTCGCTCTGTCGTCGGACTGGGAATGGTGCGCTGTCGCTAGCGATGAGTTGAGCGTCAAGATAGTC
CATACCACAGACATCACCCAGGTGAAGCACCTGCGGGAGCACGGCCGACCTGCGAGACACGTCAGCTTCGATCCC
AATGCCACGTTGGCGGCGGTTTCCTGCACGGACGGCATAGTATATGTCTACTCCTTGACCGCGGATGAGCCAGAG
CTCATACGCAAGGTCGATGGTATTATCGGCGCCCTCGAAGGCGAATCTGACACGTCGACGAGGGTGGCATGGCAT
CCCGACGGGAGGGCCTTCGCTGTTCCGACGCCGACGAGAGACATCCAAGTTGTATCGAAGCACGACTGGGAGAAG
CAACGATGTTTTGCCAATGGGCATCTAGCCGACATTACCTGCCTCGCCTGGTCGCCGAACGGGGCGATGCTGGCT
TCGGCGAGCAAGGACGGCAAGATCCTGATATGGGAGACAAAGACGCAGAGCGTCATCCAGCGCTACCATTACTCC
AATGTCGTTGATGTGGCCTGGCATCCTTCCGGTAACACCCTGTCCTTCACCACGACAGACGGAGAGGTGTTCATT
TATTCCGACTTCTTGCCCGACCAGTTCGCGCCGATGCTCAAGCTCCACCGACAACCAGCGCCGTTTATCCACGAT
CCGCTGTCGGAGGTCTCCGGCAACCGAAGGCCTCCCCAAAACAACGGCCGCAAGGGCCACGACATTCCGAGCCGG
GCACGACGAGAGTCTTTTGGTAGCCTGGATTCCCTTCTCGGCGGTGTCGACGACGTAGACGAGGACAACTTCGTC
GACGATGACGACGGTGCGGGCTACGCGGTCGGCGCAGGCAGCAAGAGAGGCCGAGACGGGGATGATTTATCCGGA
GAGCATGCCAGCAAGCGCATCAGCCTCGCGCGGCCCCTGCACCACGAGGCTTTTCAGTCCGGGTCCACGCCGTGG
CGCGGTAACAGGAAGTACCTGTGCCTGAACCTCATCGGCTTCGTCTGGACCGTCGACCAGGACTCGCACTACACG
GTGACGGTCGAGTTCTACGACCACGAGTTCCAGCGGGACTTTCACTTCACAGACACGTTTCTCTACGACAAGGCG
TGCCTCAACGAACACGGCACGCTCTTCTCGTGCCCCCCCAAAGACGACGCTCCGGCGTACATCTTCTACCGCCCA
CACGAGAGCTGGACCCAACGTTCCGACTGGCGCACGGAACTCCCACAGGGCGAGGCGGTCATGGCCATGTCGTTG
AGCGAATCCTTCGTCACCATCACGACGAGCGCGAGCTACGTCCGGGTATTTACGCTGTTCGGCATGCCTTACCGC
GTCTATCGCCCCAAGAGCACGCCGATGGTCACCTGCGCAAGCTGGAGAGACTACGTCCTCACCATCGGCAACGGG
CCGGTCGGCGCAGACGGCCGCACGCGCCTCCAATACACGATTGAAAACGTCAAGCGGGACGAGATCTGCCAAAAC
GAGGACACTGTGGCCCTGCCCGAGGGCGTGACGCTCGCGGGCGTCTTCTTCTCAGACCAAGGAGACCCTTGCATC
TACGACTCGACGGGCACGCTGCTGACGCTGCTCCATTGGCGGCAGCCATCGCGTGCGTCCTGGGTGCCCCTCTTG
GACACGAAGCTGCTGCCTCGCCTCGCCTCGGGCCGGAAGCACGAGACCTACTTCCCCGTGGCGGTGGCCGACCAC
AAGTTCCACTGCATCATCCTCAAGGGCGGCGACCGGTACCCGTACTTTCCGCGACCTCTGCTGTCCGATTTCGAG
TTTTCCATTCCGCTGGCGTCTCGGCGGAAAAAAGAGGCCCGCAAGCGCAAAGGGGCGGGCGACGGAGAGGACGAG
CGCATGGCTGGGGAAGGCGAGGAAGAGAGGGAAGAGGAGGAGGAGAAGGACGACGACGACGACGATGAAGACGAT
GGCAGGGCAGAGCGGAGGAAGCTGGAGCAGCAGTTCCTGCTCAAGGGCGTGCAGGCGGCGCAGCTACGCGACGTG
GTGGACGCGACAGCGAGCAGCCACACGCACCGGTCCCTGCTATCTCGGATCGAGCTAGACATCGACAAGGTGCTG
TTGCAGCTCCTTGCCGTGGAATGCCGGGAGGGCGAGGACCGGGGGATGCGAGCGCTGGAGATGGTGGAGCTGATG
CGCGACAGGACGGGGCGGATGATGGAGGCGGCGGGCAAGGTGGCCGAGCGGTACGGGCGCACAGTCCTCGGGGAG
AAGATCCGCGAGATTGGCGAGAAGAGAGTGGGCCGGATGGCCGAGGACGAAGATTTCTAA
Transcript >Hirsu2|1021
ATGGACTCAACAACAGCACCCCGGCCGCGCCCTCGGCCAGCACACACGCAGGGCACTACGCGCTGCGCCTACACG
GTCGACGGCTCGCGACTCGTCACAGTCGGCTCCAACAACACTATTCGCCTGTACAAGACGGGCTCCGACGGCGAA
CCCACGAACATCGACGACTGCCAGGAACAGAATGTCTCCATTTCCGTCGGTCTTGACTTCTTCGTCGTCGGATCC
GAGGACGGGACCGTCAGCCTCTACTCCCTCAGCGCCACCACTTTTGAGCGATTCCTGCTGCGCACGTCGCTGCCG
ATCCGAGAAGTCGCTCTGTCGTCGGACTGGGAATGGTGCGCTGTCGCTAGCGATGAGTTGAGCGTCAAGATAGTC
CATACCACAGACATCACCCAGGTGAAGCACCTGCGGGAGCACGGCCGACCTGCGAGACACGTCAGCTTCGATCCC
AATGCCACGTTGGCGGCGGTTTCCTGCACGGACGGCATAGTATATGTCTACTCCTTGACCGCGGATGAGCCAGAG
CTCATACGCAAGGTCGATGGTATTATCGGCGCCCTCGAAGGCGAATCTGACACGTCGACGAGGGTGGCATGGCAT
CCCGACGGGAGGGCCTTCGCTGTTCCGACGCCGACGAGAGACATCCAAGTTGTATCGAAGCACGACTGGGAGAAG
CAACGATGTTTTGCCAATGGGCATCTAGCCGACATTACCTGCCTCGCCTGGTCGCCGAACGGGGCGATGCTGGCT
TCGGCGAGCAAGGACGGCAAGATCCTGATATGGGAGACAAAGACGCAGAGCGTCATCCAGCGCTACCATTACTCC
AATGTCGTTGATGTGGCCTGGCATCCTTCCGGTAACACCCTGTCCTTCACCACGACAGACGGAGAGGTGTTCATT
TATTCCGACTTCTTGCCCGACCAGTTCGCGCCGATGCTCAAGCTCCACCGACAACCAGCGCCGTTTATCCACGAT
CCGCTGTCGGAGGTCTCCGGCAACCGAAGGCCTCCCCAAAACAACGGCCGCAAGGGCCACGACATTCCGAGCCGG
GCACGACGAGAGTCTTTTGGTAGCCTGGATTCCCTTCTCGGCGGTGTCGACGACGTAGACGAGGACAACTTCGTC
GACGATGACGACGGTGCGGGCTACGCGGTCGGCGCAGGCAGCAAGAGAGGCCGAGACGGGGATGATTTATCCGGA
GAGCATGCCAGCAAGCGCATCAGCCTCGCGCGGCCCCTGCACCACGAGGCTTTTCAGTCCGGGTCCACGCCGTGG
CGCGGTAACAGGAAGTACCTGTGCCTGAACCTCATCGGCTTCGTCTGGACCGTCGACCAGGACTCGCACTACACG
GTGACGGTCGAGTTCTACGACCACGAGTTCCAGCGGGACTTTCACTTCACAGACACGTTTCTCTACGACAAGGCG
TGCCTCAACGAACACGGCACGCTCTTCTCGTGCCCCCCCAAAGACGACGCTCCGGCGTACATCTTCTACCGCCCA
CACGAGAGCTGGACCCAACGTTCCGACTGGCGCACGGAACTCCCACAGGGCGAGGCGGTCATGGCCATGTCGTTG
AGCGAATCCTTCGTCACCATCACGACGAGCGCGAGCTACGTCCGGGTATTTACGCTGTTCGGCATGCCTTACCGC
GTCTATCGCCCCAAGAGCACGCCGATGGTCACCTGCGCAAGCTGGAGAGACTACGTCCTCACCATCGGCAACGGG
CCGGTCGGCGCAGACGGCCGCACGCGCCTCCAATACACGATTGAAAACGTCAAGCGGGACGAGATCTGCCAAAAC
GAGGACACTGTGGCCCTGCCCGAGGGCGTGACGCTCGCGGGCGTCTTCTTCTCAGACCAAGGAGACCCTTGCATC
TACGACTCGACGGGCACGCTGCTGACGCTGCTCCATTGGCGGCAGCCATCGCGTGCGTCCTGGGTGCCCCTCTTG
GACACGAAGCTGCTGCCTCGCCTCGCCTCGGGCCGGAAGCACGAGACCTACTTCCCCGTGGCGGTGGCCGACCAC
AAGTTCCACTGCATCATCCTCAAGGGCGGCGACCGGTACCCGTACTTTCCGCGACCTCTGCTGTCCGATTTCGAG
TTTTCCATTCCGCTGGCGTCTCGGCGGAAAAAAGAGGCCCGCAAGCGCAAAGGGGCGGGCGACGGAGAGGACGAG
CGCATGGCTGGGGAAGGCGAGGAAGAGAGGGAAGAGGAGGAGGAGAAGGACGACGACGACGACGATGAAGACGAT
GGCAGGGCAGAGCGGAGGAAGCTGGAGCAGCAGTTCCTGCTCAAGGGCGTGCAGGCGGCGCAGCTACGCGACGTG
GTGGACGCGACAGCGAGCAGCCACACGCACCGGTCCCTGCTATCTCGGATCGAGCTAGACATCGACAAGGTGCTG
TTGCAGCTCCTTGCCGTGGAATGCCGGGAGGGCGAGGACCGGGGGATGCGAGCGCTGGAGATGGTGGAGCTGATG
CGCGACAGGACGGGGCGGATGATGGAGGCGGCGGGCAAGGTGGCCGAGCGGTACGGGCGCACAGTCCTCGGGGAG
AAGATCCGCGAGATTGGCGAGAAGAGAGTGGGCCGGATGGCCGAGGACGAAGATTTCTAA
Gene >Hirsu2|1021
ATGGACTCAACAACAGCACCCCGGCCGCGCCCTCGGCCAGCACACACGCAGGGCACTACGCGCTGCGCCTACACG
GTCGACGGCTCGCGACTCGTCACAGTCGGCTCCAACAACACTATTCGCCTGTACAAGACGGGCTCCGACGGCGAA
CCCACGAACATCGACGACTGCCAGGAACAGAATGTCTCCATTTCCGTCGGTCTTGACTTCTTCGTCGTCGGATCC
GAGGACGGGACCGTCAGCCTCTACTCCCTCAGCGCCACCACTTTTGAGCGATTCCTGCTGCGCACGTCGCTGCCG
ATCCGAGAAGTCGCTCTGTCGTCGGACTGGGAATGGTGCGCTGTCGCTAGCGATGAGTTGAGCGTCAAGATAGTC
CATACCACAGACATCACCCAGGTGAAGCACCTGCGGGAGCACGGCCGACCTGCGAGACACGTCAGCTTCGATCCC
AATGCCACGTTGGCGGCGGTTTCCTGCACGGACGGCATAGTATATGTCTACTCCTTGACCGCGGATGAGCCAGAG
CTCATACGCAAGGTCGATGGTATTATCGGCGCCCTCGAAGGCGAATCTGACACGTCGACGAGGGTGGCATGGCAT
CCCGACGGGAGGGCCTTCGCTGTTCCGACGCCGACGAGAGACATCCAAGTTGTATCGAAGCACGACTGGGAGAAG
CAACGATGTTTTGCCAATGGGCATCTAGCCGACATTACCTGCCTCGCCTGGTCGCCGAACGGGGCGATGCTGGCT
TCGGCGAGCAAGGACGGCAAGATCCTGATATGGGAGACAAAGACGCAGAGCGTCATCCAGCGCTACCATTACTCC
AATGTCGTTGATGTGGCCTGGCATCCTTCCGGTAACACCCTGTCCTTCACCACGACAGACGGAGAGGTGTTCATT
TATTCCGACTTCTTGCCCGACCAGTTCGCGCCGATGCTCAAGCTCCACCGACAACCAGCGCCGTTTATCCACGAT
CCGCTGTCGGAGGTCTCCGGCAACCGAAGGCCTCCCCAAAACAACGGCCGCAAGGGCCACGACATTCCGAGCCGG
GCACGACGAGAGTCTTTTGGTAGCCTGGATTCCCTTCTCGGCGGTGTCGACGACGTAGACGAGGACAACTTCGTC
GACGATGACGACGGTGCGGGCTACGCGGTCGGCGCAGGCAGCAAGAGAGGCCGAGACGGGGATGATTTATCCGGA
GAGCATGCCAGCAAGCGCATCAGCCTCGCGCGGCCCCTGCACCACGAGGCTTTTCAGTCCGGGTCCACGCCGTGG
CGCGGTAACAGGAAGTACCTGTGCCTGAACCTCATCGGCTTCGTCTGGACCGTCGACCAGGACTCGCACTACACG
GTGACGGTCGAGTTCTACGACCACGAGTTCCAGCGGGACTTTCACTTCACAGACACGTTTCTCTACGACAAGGCG
TGCCTCAACGAACACGGCACGCTCTTCTCGTGCCCCCCCAAAGACGACGCTCCGGCGTACATCTTCTACCGCCCA
CACGAGAGCTGGACCCAACGTTCCGACTGGCGCACGGAACTCCCACAGGGCGAGGCGGTCATGGCCATGTCGTTG
AGCGAATCCTTCGTCACCATCACGACGAGCGCGAGCTACGTCCGGGTATTTACGCTGTTCGGCATGCCTTACCGC
GTCTATCGCCCCAAGAGCACGCCGATGGTCACCTGCGCAAGCTGGAGAGACTACGTCCTCACCATCGGCAACGGG
CCGGTCGGCGCAGACGGCCGCACGCGCCTCCAATACACGATTGAAAACGTCAAGCGGGACGAGATCTGCCAAAAC
GAGGACACTGTGGCCCTGCCCGAGGGCGTGACGCTCGCGGGCGTCTTCTTCTCAGACCAAGGAGTGAGTCGCGTC
TCGTTGCCGCCCACGACGGGCGATTGAGGAGCGCTGCTAACGTGCGCGATGCGCGACCCGCCCACCAGGACCCTT
GCATCTACGACTCGACGGGCACGCTGCTGACGCTGCTCCATTGGCGGCAGCCATCGCGTGCGTCCTGGGTGCCCC
TCTTGGACACGAAGCTGCTGCCTCGCCTCGCCTCGGGCCGGAAGCACGAGACCTACTTCCCCGTGGCGGTGGCCG
ACCACAAGTTCCACTGCATCATCCTCAAGGGCGGCGACCGGTACCCGTACTTTCCGCGACCTCTGCTGTCCGATT
TCGAGTTTTCCATTCCGCTGGCGTCTCGGCGGAAAAAAGAGGCCCGCAAGCGCAAAGGGGCGGGCGACGGAGAGG
ACGAGCGCATGGCTGGGGAAGGCGAGGAAGAGAGGGAAGAGGAGGAGGAGAAGGACGACGACGACGACGATGAAG
ACGATGGCAGGGCAGAGCGGAGGAAGCTGGAGCAGCAGTTCCTGCTCAAGGGCGTGCAGGCGGCGCAGCTACGCG
ACGTGGTGGACGCGACAGCGAGCAGCCACACGCACCGGTCCCTGCTATCTCGGATCGAGCTAGACATCGACAAGG
TGCTGTTGCAGCTCCTTGCCGTGGAATGCCGGGAGGGCGAGGACCGGGGGATGCGAGCGCTGGAGATGGTGGAGC
TGATGCGCGACAGGACGGGGCGGATGATGGAGGCGGCGGGCAAGGTGGCCGAGCGGTACGGGCGCACAGTCCTCG
GGGAGAAGATCCGCGAGATTGGCGAGAAGAGAGTGGGCCGGATGGCCGAGGACGAAGATTTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail