Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10208
Gene name
LocationContig_801:10488..10806
Strand+
Gene length (bp)318
Transcript length (bp)318
Coding sequence length (bp)318
Protein length (aa) 106

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03522 SLC12 Solute carrier family 12 7.5E-09 38 101

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P38329|VHC1_YEAST Vacuolar cation-chloride cotransporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VHC1 PE=1 SV=1 28 105 5.0E-18
sp|O60146|YNSG_SCHPO Uncharacterized transporter C18H10.16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC18H10.16 PE=1 SV=2 18 105 1.0E-11

GO

GO Term Description Terminal node
GO:0006811 ion transport Yes
GO:0016020 membrane Yes
GO:0005215 transporter activity Yes
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10208
LSDSYRNDPAAGDDSAGGSTYSTQSVALSFNDLPSRAQHLVLNELMRQQSKDTAVLLSTLPIPSEGTNLDAMATV
RYLSDVEILCYDLPPTMMVLSNNMTVTVSL*
Coding >Hirsu2|10208
CTGTCCGATTCTTATAGAAACGATCCTGCCGCCGGTGACGACTCGGCTGGCGGCTCAACATACTCGACGCAGAGC
GTGGCCCTCTCGTTCAATGATCTGCCCAGCAGGGCGCAGCATCTGGTCCTCAACGAGCTGATGCGGCAGCAGTCC
AAGGACACTGCTGTCCTGCTGAGCACCCTGCCAATACCTTCCGAGGGCACCAACCTGGATGCGATGGCGACAGTC
CGGTACCTCTCCGACGTCGAAATCCTGTGCTACGACTTGCCGCCGACGATGATGGTGCTGAGCAATAACATGACC
GTGACCGTGAGCCTGTGA
Transcript >Hirsu2|10208
CTGTCCGATTCTTATAGAAACGATCCTGCCGCCGGTGACGACTCGGCTGGCGGCTCAACATACTCGACGCAGAGC
GTGGCCCTCTCGTTCAATGATCTGCCCAGCAGGGCGCAGCATCTGGTCCTCAACGAGCTGATGCGGCAGCAGTCC
AAGGACACTGCTGTCCTGCTGAGCACCCTGCCAATACCTTCCGAGGGCACCAACCTGGATGCGATGGCGACAGTC
CGGTACCTCTCCGACGTCGAAATCCTGTGCTACGACTTGCCGCCGACGATGATGGTGCTGAGCAATAACATGACC
GTGACCGTGAGCCTGTGA
Gene >Hirsu2|10208
CTGTCCGATTCTTATAGAAACGATCCTGCCGCCGGTGACGACTCGGCTGGCGGCTCAACATACTCGACGCAGAGC
GTGGCCCTCTCGTTCAATGATCTGCCCAGCAGGGCGCAGCATCTGGTCCTCAACGAGCTGATGCGGCAGCAGTCC
AAGGACACTGCTGTCCTGCTGAGCACCCTGCCAATACCTTCCGAGGGCACCAACCTGGATGCGATGGCGACAGTC
CGGTACCTCTCCGACGTCGAAATCCTGTGCTACGACTTGCCGCCGACGATGATGGTGCTGAGCAATAACATGACC
GTGACCGTGAGCCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail