Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10207
Gene name
LocationContig_801:6697..9941
Strand+
Gene length (bp)3244
Transcript length (bp)2916
Coding sequence length (bp)2916
Protein length (aa) 972

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00324 AA_permease Amino acid permease 8.9E-58 28 493
PF13520 AA_permease_2 Amino acid permease 9.0E-17 32 453
PF03522 SLC12 Solute carrier family 12 4.4E-08 505 592

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38329|VHC1_YEAST Vacuolar cation-chloride cotransporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VHC1 PE=1 SV=1 17 833 0.0E+00
sp|O60146|YNSG_SCHPO Uncharacterized transporter C18H10.16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC18H10.16 PE=1 SV=2 16 828 0.0E+00
sp|Q0VGW6|S12A9_XENLA Solute carrier family 12 member 9 OS=Xenopus laevis GN=slc12a9 PE=2 SV=1 2 780 2.0E-136
sp|A2BFP5|S12A9_DANRE Solute carrier family 12 member 9 OS=Danio rerio GN=slc12a9 PE=3 SV=1 3 780 3.0E-125
sp|Q99MR3|S12A9_MOUSE Solute carrier family 12 member 9 OS=Mus musculus GN=Slc12a9 PE=1 SV=2 17 782 3.0E-118
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38329|VHC1_YEAST Vacuolar cation-chloride cotransporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VHC1 PE=1 SV=1 17 833 0.0E+00
sp|O60146|YNSG_SCHPO Uncharacterized transporter C18H10.16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC18H10.16 PE=1 SV=2 16 828 0.0E+00
sp|Q0VGW6|S12A9_XENLA Solute carrier family 12 member 9 OS=Xenopus laevis GN=slc12a9 PE=2 SV=1 2 780 2.0E-136
sp|A2BFP5|S12A9_DANRE Solute carrier family 12 member 9 OS=Danio rerio GN=slc12a9 PE=3 SV=1 3 780 3.0E-125
sp|Q99MR3|S12A9_MOUSE Solute carrier family 12 member 9 OS=Mus musculus GN=Slc12a9 PE=1 SV=2 17 782 3.0E-118
sp|Q66HR0|S12A9_RAT Solute carrier family 12 member 9 OS=Rattus norvegicus GN=Slc12a9 PE=1 SV=1 4 811 4.0E-118
sp|Q9BXP2|S12A9_HUMAN Solute carrier family 12 member 9 OS=Homo sapiens GN=SLC12A9 PE=1 SV=1 21 782 3.0E-116
sp|P55017|S12A3_HUMAN Solute carrier family 12 member 3 OS=Homo sapiens GN=SLC12A3 PE=1 SV=3 6 591 2.0E-76
sp|P59158|S12A3_MOUSE Solute carrier family 12 member 3 OS=Mus musculus GN=Slc12a3 PE=1 SV=1 7 591 1.0E-75
sp|P55018|S12A3_RAT Solute carrier family 12 member 3 OS=Rattus norvegicus GN=Slc12a3 PE=2 SV=2 7 591 3.0E-75
sp|P55016|S12A1_RAT Solute carrier family 12 member 1 OS=Rattus norvegicus GN=Slc12a1 PE=1 SV=1 21 591 2.0E-72
sp|P55013|S12A2_SQUAC Solute carrier family 12 member 2 OS=Squalus acanthias GN=SLC12A2 PE=1 SV=1 21 591 1.0E-71
sp|P55011|S12A2_HUMAN Solute carrier family 12 member 2 OS=Homo sapiens GN=SLC12A2 PE=1 SV=1 21 601 5.0E-70
sp|P55014|S12A1_MOUSE Solute carrier family 12 member 1 OS=Mus musculus GN=Slc12a1 PE=1 SV=2 21 591 2.0E-69
sp|P55012|S12A2_MOUSE Solute carrier family 12 member 2 OS=Mus musculus GN=Slc12a2 PE=1 SV=2 21 601 1.0E-68
sp|P55019|S12A3_PSEAM Solute carrier family 12 member 3 OS=Pseudopleuronectes americanus GN=slc12a3 PE=2 SV=1 21 591 2.0E-68
sp|P55015|S12A1_RABIT Solute carrier family 12 member 1 OS=Oryctolagus cuniculus GN=SLC12A1 PE=2 SV=1 21 591 2.0E-67
sp|Q25479|NKCL_MANSE Bumetanide-sensitive sodium-(potassium)-chloride cotransporter OS=Manduca sexta PE=2 SV=1 21 591 5.0E-67
sp|Q13621|S12A1_HUMAN Solute carrier family 12 member 1 OS=Homo sapiens GN=SLC12A1 PE=1 SV=2 11 591 6.0E-67
sp|Q657W3|CCC2_ORYSJ Cation-chloride cotransporter 2 OS=Oryza sativa subsp. japonica GN=CCC2 PE=2 SV=2 5 607 1.0E-65
sp|Q2UVJ5|CCC1_ARATH Cation-chloride cotransporter 1 OS=Arabidopsis thaliana GN=CCC1 PE=1 SV=1 2 607 2.0E-62
sp|Q6Z0E2|CCC1_ORYSJ Cation-chloride cotransporter 1 OS=Oryza sativa subsp. japonica GN=CCC1 PE=2 SV=1 2 607 2.0E-60
sp|Q63632|S12A4_RAT Solute carrier family 12 member 4 OS=Rattus norvegicus GN=Slc12a4 PE=1 SV=1 227 591 4.0E-54
sp|Q5RK27|S12A7_RAT Solute carrier family 12 member 7 OS=Rattus norvegicus GN=Slc12a7 PE=2 SV=2 226 591 5.0E-54
sp|Q9UP95|S12A4_HUMAN Solute carrier family 12 member 4 OS=Homo sapiens GN=SLC12A4 PE=1 SV=2 227 591 6.0E-54
sp|Q9WVL3|S12A7_MOUSE Solute carrier family 12 member 7 OS=Mus musculus GN=Slc12a7 PE=1 SV=1 226 591 1.0E-53
sp|Q28677|S12A4_RABIT Solute carrier family 12 member 4 OS=Oryctolagus cuniculus GN=SLC12A4 PE=1 SV=1 227 591 1.0E-53
sp|Q9JIS8|S12A4_MOUSE Solute carrier family 12 member 4 OS=Mus musculus GN=Slc12a4 PE=1 SV=2 227 591 1.0E-53
sp|Q9UHW9|S12A6_HUMAN Solute carrier family 12 member 6 OS=Homo sapiens GN=SLC12A6 PE=1 SV=2 227 593 3.0E-53
sp|Q924N4|S12A6_MOUSE Solute carrier family 12 member 6 OS=Mus musculus GN=Slc12a6 PE=1 SV=2 227 593 3.0E-53
sp|Q9Y666|S12A7_HUMAN Solute carrier family 12 member 7 OS=Homo sapiens GN=SLC12A7 PE=1 SV=3 228 591 1.0E-52
sp|Q7YRU6|S12A7_RABIT Solute carrier family 12 member 7 OS=Oryctolagus cuniculus GN=SLC12A7 PE=1 SV=1 227 591 2.0E-52
sp|Q91V14|S12A5_MOUSE Solute carrier family 12 member 5 OS=Mus musculus GN=Slc12a5 PE=1 SV=2 229 591 7.0E-50
sp|Q63633|S12A5_RAT Solute carrier family 12 member 5 OS=Rattus norvegicus GN=Slc12a5 PE=1 SV=2 229 591 8.0E-50
sp|Q9H2X9|S12A5_HUMAN Solute carrier family 12 member 5 OS=Homo sapiens GN=SLC12A5 PE=2 SV=3 229 591 2.0E-49
sp|Q8VI23|S12A8_MOUSE Solute carrier family 12 member 8 OS=Mus musculus GN=Slc12a8 PE=2 SV=2 22 410 2.0E-34
sp|A0AV02|S12A8_HUMAN Solute carrier family 12 member 8 OS=Homo sapiens GN=SLC12A8 PE=2 SV=4 22 405 3.0E-32
sp|Q6A4L1|S12A8_XENLA Solute carrier family 12 member 8 OS=Xenopus laevis GN=slc12a8 PE=2 SV=1 22 422 6.0E-30
sp|Q09573|KCC3_CAEEL Sodium/chloride cotransporter 3 OS=Caenorhabditis elegans GN=kcc-3 PE=4 SV=1 202 593 1.0E-28
sp|Q8CJI3|S12A8_RAT Solute carrier family 12 member 8 OS=Rattus norvegicus GN=Slc12a8 PE=2 SV=1 22 402 1.0E-27
sp|Q924N4|S12A6_MOUSE Solute carrier family 12 member 6 OS=Mus musculus GN=Slc12a6 PE=1 SV=2 16 126 4.0E-20
sp|Q9UHW9|S12A6_HUMAN Solute carrier family 12 member 6 OS=Homo sapiens GN=SLC12A6 PE=1 SV=2 16 126 9.0E-20
sp|Q28677|S12A4_RABIT Solute carrier family 12 member 4 OS=Oryctolagus cuniculus GN=SLC12A4 PE=1 SV=1 18 128 6.0E-19
sp|Q63632|S12A4_RAT Solute carrier family 12 member 4 OS=Rattus norvegicus GN=Slc12a4 PE=1 SV=1 18 128 7.0E-19
sp|Q9UP95|S12A4_HUMAN Solute carrier family 12 member 4 OS=Homo sapiens GN=SLC12A4 PE=1 SV=2 22 128 7.0E-19
sp|Q9JIS8|S12A4_MOUSE Solute carrier family 12 member 4 OS=Mus musculus GN=Slc12a4 PE=1 SV=2 18 128 7.0E-19
sp|Q5RK27|S12A7_RAT Solute carrier family 12 member 7 OS=Rattus norvegicus GN=Slc12a7 PE=2 SV=2 18 126 3.0E-18
sp|Q9WVL3|S12A7_MOUSE Solute carrier family 12 member 7 OS=Mus musculus GN=Slc12a7 PE=1 SV=1 18 126 3.0E-18
sp|Q9Y666|S12A7_HUMAN Solute carrier family 12 member 7 OS=Homo sapiens GN=SLC12A7 PE=1 SV=3 18 126 6.0E-18
sp|Q91V14|S12A5_MOUSE Solute carrier family 12 member 5 OS=Mus musculus GN=Slc12a5 PE=1 SV=2 16 126 8.0E-18
sp|Q63633|S12A5_RAT Solute carrier family 12 member 5 OS=Rattus norvegicus GN=Slc12a5 PE=1 SV=2 16 126 8.0E-18
sp|Q9H2X9|S12A5_HUMAN Solute carrier family 12 member 5 OS=Homo sapiens GN=SLC12A5 PE=2 SV=3 16 126 8.0E-18
sp|Q7YRU6|S12A7_RABIT Solute carrier family 12 member 7 OS=Oryctolagus cuniculus GN=SLC12A7 PE=1 SV=1 17 126 3.0E-17
sp|Q09573|KCC3_CAEEL Sodium/chloride cotransporter 3 OS=Caenorhabditis elegans GN=kcc-3 PE=4 SV=1 22 128 3.0E-17
sp|P34261|YKAA_CAEEL Uncharacterized amino-acid permease B0303.11 OS=Caenorhabditis elegans GN=B0303.11/B0303.12 PE=3 SV=6 28 591 3.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0006811 ion transport Yes
GO:0055085 transmembrane transport Yes
GO:0016020 membrane Yes
GO:0022857 transmembrane transporter activity Yes
GO:0005215 transporter activity Yes
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.5

Transmembrane Domains

Domain # Start End Length
1 20 42 22
2 49 71 22
3 101 123 22
4 144 166 22
5 171 189 18
6 232 249 17
7 264 286 22
8 306 328 22
9 356 375 19
10 382 404 22
11 414 433 19
12 438 457 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10207
MSSPGGKVGLQAGLAPPRSGRLGLLSGVFVPVFLSVMSILMFLRFGIILGRVGFVGIAGLLVAAYCIDLLTTLSL
SAIASNGEVKGGGAYFLISRSLGPEFGGSIGLLFFIAQALNTALNIVGLIDCIRLNVGSAFPHGYWAGYGLQTAA
LVLCTGLCLLGSATFSKASKALLVILTLAIASIPLSALFKTPFHDEALGVEFTGASWDTLAANMLPQTSSSHYHG
LTTFRDLFGILFPATAGIFAGASLSGDLKNPSKAIPKGTLWATFTTFILYMLVIVSLAASTTRDSLLANANIVLL
TNLSPPLILAGECSVTFVSALICMMGSANLFQALAKDALLPGLSVFGRGSKKNDDPILAILLTHIIAQVALLANL
NRIATLISMGYQMTFLVMNLACFLLKIGSAPNFRPGFKFFSWQTALVGSLLSASAMFFINETYASVAICILVFLF
LLIHYLCPPKRWGDVSQNLIYHQVRKYLLRLKPEHIKFWRPHIILLVNNPRRQTRLIQFCNSMKKGSLYILGHTI
VTDHFDSGVHEARLQQQAWANYISEFTKIKAFLQLTISPSVVWGIRNLILSAGLGGMRPNIAVLGFYNMDDLRRS
DPVLTIPEVPAAAASRAKLPPNAEGKAPLRRRVDTSTRLLAGTLPTDVIRTEGMMSPTDYMIVLEDLALRYRLNV
AVAHGFESLETPRAGSSHTKKYVDLWPIQMSAEVASDGKNVLTTNFDTYTLILQLGHILRSVPNWRRAYSLRVMV
FVEYESEVEEESARVRALLEKLRIEAQVHVFWLAAGHLGTYELIINGQTDNAETEIIVNEALKHEEWWEDLQSFR
GQSDGRTRNQDTVQLAHIIGSTAGRPGVYNPHEEGSSDRRRSSVTEVTEMPKRPDISLLSKWGVNVGIHTHHLPE
DVLHEPKLDEALRTIAECSDSDGEQGFDLGDSAARGPKAKIRTRPQVPAHGFRHPATADLRVHIDLFDRGG*
Coding >Hirsu2|10207
ATGTCGTCGCCAGGCGGCAAGGTTGGCCTTCAGGCCGGCCTGGCGCCCCCAAGGAGCGGCAGGCTCGGCCTTCTG
TCGGGCGTCTTCGTCCCCGTCTTTCTCAGCGTCATGAGCATTCTCATGTTCCTGCGCTTCGGCATCATCCTCGGC
CGCGTCGGCTTCGTGGGCATTGCAGGACTCCTGGTCGCGGCATACTGCATTGACCTGCTCACTACTCTTTCGCTC
TCCGCCATTGCATCCAATGGCGAGGTCAAGGGCGGCGGCGCCTACTTCCTCATCTCGAGGTCCCTCGGCCCCGAG
TTCGGTGGCTCCATCGGCCTCCTGTTCTTCATCGCACAGGCCCTCAATACCGCTCTCAACATCGTCGGTCTCATC
GACTGCATTCGACTCAATGTTGGGTCCGCCTTCCCCCACGGCTATTGGGCCGGCTATGGCTTGCAGACGGCGGCT
CTGGTCCTCTGCACGGGGCTGTGTCTCTTGGGATCGGCCACCTTCTCCAAGGCCTCGAAAGCCTTGCTTGTCATT
CTGACCCTCGCCATCGCCAGTATCCCACTATCCGCCCTGTTCAAAACTCCCTTTCACGATGAGGCTTTGGGGGTT
GAGTTCACCGGCGCTAGCTGGGACACGCTGGCTGCCAACATGCTGCCTCAAACGAGTAGCAGCCACTACCACGGC
CTGACAACATTTCGTGATCTCTTTGGCATCCTCTTCCCAGCCACTGCTGGGATCTTCGCCGGCGCCTCCCTTTCC
GGCGACCTGAAGAACCCGAGCAAGGCCATTCCCAAGGGAACTCTGTGGGCCACGTTCACAACCTTTATTCTCTAC
ATGTTGGTCATCGTTTCTCTGGCCGCCAGCACCACGCGGGACTCGCTGCTCGCCAACGCCAACATTGTCCTTCTC
ACCAACTTGTCGCCACCGCTCATCCTGGCTGGAGAGTGCTCCGTCACCTTTGTTTCCGCCCTGATATGCATGATG
GGTTCCGCGAACCTGTTTCAAGCCCTTGCCAAGGATGCCCTTCTTCCCGGCCTGTCTGTCTTCGGGAGGGGCTCG
AAGAAGAATGACGATCCCATTCTCGCCATTCTCCTGACCCACATCATCGCTCAGGTCGCTTTGCTGGCCAACTTG
AACCGCATTGCGACCTTGATCTCCATGGGATACCAGATGACATTCCTCGTCATGAACCTCGCCTGCTTCCTTCTC
AAAATCGGGTCGGCCCCCAACTTTCGCCCGGGCTTCAAATTCTTCAGTTGGCAGACGGCCCTCGTCGGTAGCCTT
TTGTCGGCCTCGGCCATGTTCTTCATCAACGAGACCTACGCTTCCGTGGCCATCTGCATTCTCGTCTTCCTTTTC
CTCCTCATTCACTATCTCTGCCCGCCGAAGCGGTGGGGCGACGTGTCGCAGAACCTCATCTATCACCAAGTGAGG
AAGTATTTGTTGCGGTTGAAGCCAGAGCACATCAAGTTCTGGAGGCCGCACATCATACTGCTAGTCAACAACCCG
CGCCGTCAGACTCGTCTGATTCAGTTCTGCAACTCAATGAAGAAGGGTTCTCTCTACATCCTCGGTCACACCATC
GTTACCGACCACTTCGACAGCGGAGTCCACGAGGCCCGCCTGCAGCAACAAGCCTGGGCGAACTACATCTCCGAA
TTCACCAAGATCAAGGCCTTCCTGCAACTGACAATATCGCCCTCCGTCGTGTGGGGCATCCGGAACCTGATCTTG
TCCGCCGGCCTCGGCGGCATGCGGCCTAACATCGCCGTCCTGGGCTTCTACAACATGGATGACCTCCGTAGGTCT
GACCCGGTACTGACGATCCCCGAAGTCCCCGCGGCGGCGGCATCCAGGGCGAAGCTGCCACCGAACGCCGAGGGA
AAGGCACCTTTGCGACGCAGAGTGGACACGTCCACTCGTCTGCTGGCTGGGACCCTGCCAACGGACGTGATCCGA
ACAGAGGGCATGATGTCTCCAACAGATTACATGATTGTGCTGGAGGACCTCGCGCTTAGGTATCGCCTCAACGTC
GCTGTGGCACACGGATTTGAATCGCTCGAAACACCACGAGCAGGCAGCTCCCACACCAAGAAATACGTCGATCTA
TGGCCCATTCAGATGTCGGCGGAAGTCGCTTCCGACGGCAAGAACGTTTTGACGACAAACTTCGACACTTATACC
TTGATCCTCCAGCTGGGACACATACTGCGCAGCGTCCCGAACTGGCGCCGTGCCTACTCGCTTCGGGTCATGGTT
TTCGTGGAGTACGAGAGCGAGGTAGAGGAAGAGAGTGCACGGGTAAGGGCACTTCTTGAGAAGCTGCGGATCGAG
GCCCAAGTGCACGTCTTCTGGCTGGCTGCGGGACACCTTGGCACGTACGAGCTCATCATCAACGGGCAGACCGAC
AACGCCGAAACCGAGATCATTGTCAACGAGGCGCTCAAGCACGAAGAGTGGTGGGAAGATCTACAATCCTTCCGT
GGACAGTCTGACGGCAGGACGCGAAACCAGGATACGGTGCAGCTGGCGCACATTATCGGCTCTACCGCCGGTCGT
CCCGGCGTCTACAACCCACATGAAGAGGGCAGCTCGGACCGTCGTCGCTCGAGCGTGACCGAAGTCACCGAAATG
CCCAAGAGACCCGACATCTCCCTGCTCTCCAAGTGGGGTGTCAACGTGGGCATACACACCCATCACCTCCCGGAG
GATGTCCTGCACGAACCGAAGCTCGACGAAGCATTGCGCACGATTGCTGAGTGCTCCGACTCGGATGGAGAGCAA
GGCTTCGATCTGGGCGACTCCGCCGCTCGCGGACCAAAGGCCAAAATTCGGACGCGGCCGCAAGTCCCGGCTCAC
GGATTCCGGCACCCCGCAACCGCCGACCTACGGGTCCATATCGACCTCTTCGACCGCGGTGGATAA
Transcript >Hirsu2|10207
ATGTCGTCGCCAGGCGGCAAGGTTGGCCTTCAGGCCGGCCTGGCGCCCCCAAGGAGCGGCAGGCTCGGCCTTCTG
TCGGGCGTCTTCGTCCCCGTCTTTCTCAGCGTCATGAGCATTCTCATGTTCCTGCGCTTCGGCATCATCCTCGGC
CGCGTCGGCTTCGTGGGCATTGCAGGACTCCTGGTCGCGGCATACTGCATTGACCTGCTCACTACTCTTTCGCTC
TCCGCCATTGCATCCAATGGCGAGGTCAAGGGCGGCGGCGCCTACTTCCTCATCTCGAGGTCCCTCGGCCCCGAG
TTCGGTGGCTCCATCGGCCTCCTGTTCTTCATCGCACAGGCCCTCAATACCGCTCTCAACATCGTCGGTCTCATC
GACTGCATTCGACTCAATGTTGGGTCCGCCTTCCCCCACGGCTATTGGGCCGGCTATGGCTTGCAGACGGCGGCT
CTGGTCCTCTGCACGGGGCTGTGTCTCTTGGGATCGGCCACCTTCTCCAAGGCCTCGAAAGCCTTGCTTGTCATT
CTGACCCTCGCCATCGCCAGTATCCCACTATCCGCCCTGTTCAAAACTCCCTTTCACGATGAGGCTTTGGGGGTT
GAGTTCACCGGCGCTAGCTGGGACACGCTGGCTGCCAACATGCTGCCTCAAACGAGTAGCAGCCACTACCACGGC
CTGACAACATTTCGTGATCTCTTTGGCATCCTCTTCCCAGCCACTGCTGGGATCTTCGCCGGCGCCTCCCTTTCC
GGCGACCTGAAGAACCCGAGCAAGGCCATTCCCAAGGGAACTCTGTGGGCCACGTTCACAACCTTTATTCTCTAC
ATGTTGGTCATCGTTTCTCTGGCCGCCAGCACCACGCGGGACTCGCTGCTCGCCAACGCCAACATTGTCCTTCTC
ACCAACTTGTCGCCACCGCTCATCCTGGCTGGAGAGTGCTCCGTCACCTTTGTTTCCGCCCTGATATGCATGATG
GGTTCCGCGAACCTGTTTCAAGCCCTTGCCAAGGATGCCCTTCTTCCCGGCCTGTCTGTCTTCGGGAGGGGCTCG
AAGAAGAATGACGATCCCATTCTCGCCATTCTCCTGACCCACATCATCGCTCAGGTCGCTTTGCTGGCCAACTTG
AACCGCATTGCGACCTTGATCTCCATGGGATACCAGATGACATTCCTCGTCATGAACCTCGCCTGCTTCCTTCTC
AAAATCGGGTCGGCCCCCAACTTTCGCCCGGGCTTCAAATTCTTCAGTTGGCAGACGGCCCTCGTCGGTAGCCTT
TTGTCGGCCTCGGCCATGTTCTTCATCAACGAGACCTACGCTTCCGTGGCCATCTGCATTCTCGTCTTCCTTTTC
CTCCTCATTCACTATCTCTGCCCGCCGAAGCGGTGGGGCGACGTGTCGCAGAACCTCATCTATCACCAAGTGAGG
AAGTATTTGTTGCGGTTGAAGCCAGAGCACATCAAGTTCTGGAGGCCGCACATCATACTGCTAGTCAACAACCCG
CGCCGTCAGACTCGTCTGATTCAGTTCTGCAACTCAATGAAGAAGGGTTCTCTCTACATCCTCGGTCACACCATC
GTTACCGACCACTTCGACAGCGGAGTCCACGAGGCCCGCCTGCAGCAACAAGCCTGGGCGAACTACATCTCCGAA
TTCACCAAGATCAAGGCCTTCCTGCAACTGACAATATCGCCCTCCGTCGTGTGGGGCATCCGGAACCTGATCTTG
TCCGCCGGCCTCGGCGGCATGCGGCCTAACATCGCCGTCCTGGGCTTCTACAACATGGATGACCTCCGTAGGTCT
GACCCGGTACTGACGATCCCCGAAGTCCCCGCGGCGGCGGCATCCAGGGCGAAGCTGCCACCGAACGCCGAGGGA
AAGGCACCTTTGCGACGCAGAGTGGACACGTCCACTCGTCTGCTGGCTGGGACCCTGCCAACGGACGTGATCCGA
ACAGAGGGCATGATGTCTCCAACAGATTACATGATTGTGCTGGAGGACCTCGCGCTTAGGTATCGCCTCAACGTC
GCTGTGGCACACGGATTTGAATCGCTCGAAACACCACGAGCAGGCAGCTCCCACACCAAGAAATACGTCGATCTA
TGGCCCATTCAGATGTCGGCGGAAGTCGCTTCCGACGGCAAGAACGTTTTGACGACAAACTTCGACACTTATACC
TTGATCCTCCAGCTGGGACACATACTGCGCAGCGTCCCGAACTGGCGCCGTGCCTACTCGCTTCGGGTCATGGTT
TTCGTGGAGTACGAGAGCGAGGTAGAGGAAGAGAGTGCACGGGTAAGGGCACTTCTTGAGAAGCTGCGGATCGAG
GCCCAAGTGCACGTCTTCTGGCTGGCTGCGGGACACCTTGGCACGTACGAGCTCATCATCAACGGGCAGACCGAC
AACGCCGAAACCGAGATCATTGTCAACGAGGCGCTCAAGCACGAAGAGTGGTGGGAAGATCTACAATCCTTCCGT
GGACAGTCTGACGGCAGGACGCGAAACCAGGATACGGTGCAGCTGGCGCACATTATCGGCTCTACCGCCGGTCGT
CCCGGCGTCTACAACCCACATGAAGAGGGCAGCTCGGACCGTCGTCGCTCGAGCGTGACCGAAGTCACCGAAATG
CCCAAGAGACCCGACATCTCCCTGCTCTCCAAGTGGGGTGTCAACGTGGGCATACACACCCATCACCTCCCGGAG
GATGTCCTGCACGAACCGAAGCTCGACGAAGCATTGCGCACGATTGCTGAGTGCTCCGACTCGGATGGAGAGCAA
GGCTTCGATCTGGGCGACTCCGCCGCTCGCGGACCAAAGGCCAAAATTCGGACGCGGCCGCAAGTCCCGGCTCAC
GGATTCCGGCACCCCGCAACCGCCGACCTACGGGTCCATATCGACCTCTTCGACCGCGGTGGATAA
Gene >Hirsu2|10207
ATGTCGTCGCCAGGCGGCAAGGTTGGCCTTCAGGCCGGCCTGGCGCCCCCAAGGAGCGGCAGGCTCGGCCTTCTG
TCGGGCGTCTTCGTCCCCGTCTTTCTCAGCGTCATGAGCATTCTCATGTTCCTGCGCTTCGGCATCATCCTCGGC
CGCGTCGGCTTCGTGGGCATTGCAGGTACCGCCATCTCCGCCCTCCGCTTCACAGCCCCGCCGCTGACCACACGA
GCCCGCCACAGGACTCCTGGTCGCGGCATACTGCATTGACCTGCTCACTACTCTTTCGCTCTCCGCCATTGCATC
CAATGGCGAGGTCAAGGGCGGCGGCGCCTACTTCCTCATCTCGAGGTCCCTCGGCCCCGAGTTCGGTGGCTCCAT
CGGCCTCCTGTTCTTCATCGCACAGGCCCTCAATACCGCTCTCAACATCGTCGGTCTCATCGACTGCATTCGACT
CAATGTTGGGTCCGCCTTCCCCCACGGCTATTGGGCCGGCTATGGCTTGCAGACGGCGGCTCTGGTCCTCTGCAC
GGGGCTGTGTCTCTTGGGATCGGCCACCTTCTCCAAGGCCTCGAAAGCCTTGCTTGTCATTCTGACCCTCGCCAT
CGCCAGTATCCCACTATCCGCCCTGTTCAAAACTCCCTTTCACGATGAGGCTTTGGGGGTTGAGTTCACCGGCGC
TAGCTGGGACACGCTGGCTGCCAACATGCTGCCTCAAACGAGTAGCAGCCACTACCACGGCCTGACAACATTTCG
TGATCTCTTTGGCATCCTCTTCCCGTACGTTGCCGAACCGGATATTCCCATTGTCGTGCTCCCGGCATCACTGAC
GCGTTGTCTAGAGCCACTGCTGGGATCTTCGCCGGCGCCTCCCTTTCCGGCGACCTGAAGAACCCGAGCAAGGCC
ATTCCCAAGGGAACTCTGTGGGCCACGTTCACAACCTTTATTCTCTACATGTTGGTCATCGTTTCTCTGGCCGCC
AGCACCACGCGGGACTCGCTGCTCGCCAACGCCAACATTGTCCTTCTCACCAACTTGTCGCCACCGCTCATCCTG
GCTGGAGAGTGCTCCGTCACCTTTGTTTCCGCCCTGATATGCATGATGGGTTCCGCGAACCTGTTTCAAGCCCTT
GCCAAGGATGCCCTTCTTCCCGGCCTGTCTGTCTTCGGGAGGGGCTCGAAGAAGAATGACGATCCCATTCTCGCC
ATTCTCCTGACCCACATCATCGCTCAGGTCGCTTTGCTGGCCAACTTGAACCGCATTGCGACCTTGATCTCCATG
GGATACCAGGTACGTCACCCACTCCTCTGCTCCAGATGGCGGGCAACCTCGTCCTGATCGCTGCAGATGACATTC
CTCGTCATGAACCTCGCCTGCTTCCTTCTCAAAATCGGGTCGGCCCCCAACTTTCGCCCGGGCTTCAAATTCTTC
AGTTGGCAGACGGCCCTCGTCGGTAGCCTTTTGTCGGCCTCGGCCATGTTCTTCATCAACGAGACCTACGCTTCC
GTGGCCATCTGCATTCTCGTCTTCCTTTTCCTCCTCATTCACTATCTCTGCCCGCCGAAGCGGTGGGGCGACGTG
TCGCAGAACCTCATCTATCACCAAGTGAGGAAGTATTTGTTGCGGTTGAAGCCAGAGCACATCAAGTTCTGGAGG
CCGCACATCATACTGCTAGTCAACAACCCGCGCCGTCAGACTCGTCTGATTCAGTTCTGCAACTCAATGAAGAAG
GGTTCTCTCTACATCCTCGGTCACACCATCGTTACCGACCACTTCGACAGCGGAGTCCACGAGGCCCGCCTGCAG
CAACAAGCCTGGGCGAACTACATCTCCGAATTCACCAAGATCAAGGCCTTCCTGCAACTGACAATATCGCCCTCC
GTCGTGTGGGGCATCCGGAACCTGATCTTGTCCGCCGGCCTCGGCGGCATGCGGCCTAACATCGCCGTCCTGGGC
TTCTACAACATGGATGACCTCCGTAGGTCTGACCCGGTACTGACGATCCCCGAAGTCCCCGCGGCGGCGGCATCC
AGGGCGAAGCTGCCACCGAACGCCGAGGGAAAGGCACCTTTGCGACGCAGAGTGGACACGTCCACTCGTCTGCTG
GCTGGGACCCTGCCAACGGACGTGATCCGAACAGAGGGCATGATGTCTCCAACAGATTACATGATTGTGCTGGAG
GACCTCGCGCTTAGGTATCGCCTCAACGTCGCTGTGGCACACGGATTTGAATCGCTCGAAACACCACGAGCAGGC
AGCTCCCACACCAAGAAATACGTCGATCTATGGCCCATTCAGATGTCGGCGGAAGTCGCTTCCGACGGCAAGAAC
GTTTTGACGACAAACTTCGACACTTGTATGTCCCTTGAAGCGACATTTGTTCTCCGCCTGTACCCCGCAATTCGT
TCATTCGCGCGCGCTGCTTAGTTTTCGCTGCTGACCCATGGCCAGATACCTTGATCCTCCAGCTGGGACACATAC
TGCGCAGCGTCCCGAACTGGCGCCGTGCCTACTCGCTTCGGGTCATGGTTTTCGTGGAGTACGAGAGCGAGGTAG
AGGAAGAGAGTGCACGGGTAAGGGCACTTCTTGAGAAGCTGCGGATCGAGGCCCAAGTGCACGTCTTCTGGCTGG
CTGCGGGACACCTTGGCACGTACGAGCTCATCATCAACGGGCAGACCGACAACGCCGAAACCGAGATCATTGTCA
ACGAGGCGCTCAAGCACGAAGAGTGGTGGGAAGATCTACAATCCTTCCGTGGACAGTCTGACGGCAGGACGCGAA
ACCAGGATACGGTGCAGCTGGCGCACATTATCGGCTCTACCGCCGGTCGTCCCGGCGTCTACAACCCACATGAAG
AGGGCAGCTCGGACCGTCGTCGCTCGAGCGTGACCGAAGTCACCGAAATGCCCAAGAGACCCGACATCTCCCTGC
TCTCCAAGTGGGGTGTCAACGTGGGCATACACACCCATCACCTCCCGGAGGATGTCCTGCACGAACCGAAGCTCG
ACGAAGCATTGCGCACGATTGCTGAGTGCTCCGACTCGGATGGAGAGCAAGGCTTCGATCTGGGCGACTCCGCCG
CTCGCGGACGTGCCGAAGCCGCCGAACCGGCAAGGCGACCACTGCTAGCAAGGGGACACCAGCAAAGGCCAAAAT
TCGGACGCGGCCGCAAGTCCCGGCTCACGGATTCCGGCACCCCGCAACCGCCGACCTACGGGTCCATATCGACCT
CTTCGACCGCGGTGGATAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail