Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10204
Gene name
LocationContig_801:1280..3601
Strand-
Gene length (bp)2321
Transcript length (bp)2268
Coding sequence length (bp)2268
Protein length (aa) 756

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01490 Aa_trans Transmembrane amino acid transporter protein 3.8E-84 354 736

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10074|AVT3_SCHPO Vacuolar amino acid transporter 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=avt3 PE=1 SV=1 90 735 3.0E-168
sp|P36062|AVT3_YEAST Vacuolar amino acid transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT3 PE=1 SV=1 192 741 1.0E-142
sp|P50944|AVT4_YEAST Vacuolar amino acid transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT4 PE=1 SV=1 96 737 4.0E-127
sp|Q7Z2H8|S36A1_HUMAN Proton-coupled amino acid transporter 1 OS=Homo sapiens GN=SLC36A1 PE=1 SV=1 310 702 4.0E-36
sp|Q495N2|S36A3_HUMAN Proton-coupled amino acid transporter 3 OS=Homo sapiens GN=SLC36A3 PE=2 SV=2 316 730 7.0E-32
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10074|AVT3_SCHPO Vacuolar amino acid transporter 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=avt3 PE=1 SV=1 90 735 3.0E-168
sp|P36062|AVT3_YEAST Vacuolar amino acid transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT3 PE=1 SV=1 192 741 1.0E-142
sp|P50944|AVT4_YEAST Vacuolar amino acid transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT4 PE=1 SV=1 96 737 4.0E-127
sp|Q7Z2H8|S36A1_HUMAN Proton-coupled amino acid transporter 1 OS=Homo sapiens GN=SLC36A1 PE=1 SV=1 310 702 4.0E-36
sp|Q495N2|S36A3_HUMAN Proton-coupled amino acid transporter 3 OS=Homo sapiens GN=SLC36A3 PE=2 SV=2 316 730 7.0E-32
sp|Q924A5|S36A1_RAT Proton-coupled amino acid transporter 1 OS=Rattus norvegicus GN=Slc36a1 PE=2 SV=1 310 702 6.0E-31
sp|Q4KL91|S36A4_XENLA Proton-coupled amino acid transporter 4 OS=Xenopus laevis GN=slc36a4 PE=2 SV=1 301 736 1.0E-30
sp|Q8K4D3|S36A1_MOUSE Proton-coupled amino acid transporter 1 OS=Mus musculus GN=Slc36a1 PE=2 SV=1 310 732 4.0E-30
sp|Q6YBV0|S36A4_HUMAN Proton-coupled amino acid transporter 4 OS=Homo sapiens GN=SLC36A4 PE=1 SV=1 298 736 2.0E-29
sp|Q811P0|S36A3_MOUSE Proton-coupled amino acid transporter 3 OS=Mus musculus GN=Slc36a3 PE=2 SV=1 345 732 3.0E-28
sp|Q4V8B1|S36A3_RAT Proton-coupled amino acid transporter 3 OS=Rattus norvegicus GN=Slc36a3 PE=2 SV=1 346 730 8.0E-28
sp|Q8CH36|S36A4_MOUSE Proton-coupled amino acid transporter 4 OS=Mus musculus GN=Slc36a4 PE=2 SV=1 298 732 1.0E-27
sp|Q495M3|S36A2_HUMAN Proton-coupled amino acid transporter 2 OS=Homo sapiens GN=SLC36A2 PE=1 SV=1 323 702 2.0E-27
sp|Q9SVG0|ANTL2_ARATH Amino acid transporter ANTL2 OS=Arabidopsis thaliana GN=At4g38250 PE=1 SV=1 353 713 6.0E-26
sp|Q8BHK3|S36A2_MOUSE Proton-coupled amino acid transporter 2 OS=Mus musculus GN=Slc36a2 PE=1 SV=1 364 638 3.0E-25
sp|Q8K415|S36A2_RAT Proton-coupled amino acid transporter 2 OS=Rattus norvegicus GN=Slc36a2 PE=1 SV=1 347 638 9.0E-25
sp|F4ILY9|ANTL1_ARATH Amino acid transporter ANTL1 OS=Arabidopsis thaliana GN=At2g42005 PE=2 SV=1 337 714 2.0E-24
sp|Q9FKY3|ANTL3_ARATH Amino acid transporter ANTL3 OS=Arabidopsis thaliana GN=At5g65990 PE=2 SV=1 330 724 9.0E-21
sp|Q9SF09|ANT1_ARATH Amino acid transporter ANT1 OS=Arabidopsis thaliana GN=ANT1 PE=1 SV=1 324 737 5.0E-20
sp|P34479|SKAT1_CAEEL Probable amino acid transporter skat-1 OS=Caenorhabditis elegans GN=skat-1 PE=2 SV=2 316 714 6.0E-11
sp|Q6DEL1|S38A7_DANRE Putative sodium-coupled neutral amino acid transporter 7 OS=Danio rerio GN=slc38a7 PE=2 SV=1 304 639 3.0E-10
sp|Q503G8|S38A6_DANRE Probable sodium-coupled neutral amino acid transporter 6 OS=Danio rerio GN=slc38a6 PE=2 SV=1 315 741 5.0E-10
sp|Q99624|S38A3_HUMAN Sodium-coupled neutral amino acid transporter 3 OS=Homo sapiens GN=SLC38A3 PE=1 SV=1 302 748 5.0E-10
sp|Q5XH90|S38A2_XENTR Sodium-coupled neutral amino acid transporter 2 OS=Xenopus tropicalis GN=slc38a2 PE=2 SV=1 336 741 2.0E-08
sp|D3Z813|S38AB_RAT Putative sodium-coupled neutral amino acid transporter 11 OS=Rattus norvegicus GN=Slc38a11 PE=2 SV=1 339 705 3.0E-07
sp|Q5EA97|S38AB_BOVIN Putative sodium-coupled neutral amino acid transporter 11 OS=Bos taurus GN=SLC38A11 PE=2 SV=1 336 738 1.0E-06
sp|Q6PCF9|S38AA_XENLA Putative sodium-coupled neutral amino acid transporter 10 OS=Xenopus laevis GN=slc38a10 PE=2 SV=1 364 736 2.0E-06
sp|P39981|AVT2_YEAST Vacuolar amino acid transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT2 PE=2 SV=1 320 742 3.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

Domain # Start End Length
1 385 407 22
2 428 450 22
3 470 489 19
4 496 518 22
5 538 557 19
6 570 592 22
7 616 638 22
8 659 676 17
9 682 704 22
10 717 739 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10204
MSSPRNTLNPPPGPASPAPGQSRSFSSSLPREELTARLAEPIPSGNTPTRSRSPAPAAKAPETDTPLVGGRSYAQ
GPGVSALAAALSDSLGQSPPRHGTPPARVASPPPRAQSPVLRGRADTPTNYGSLDSRSRPGPGSVVGPYEDPEIV
KRHLVQPGESENLPSEDSSTIGPTRGKQPAEATAGLNDDEFSSLRLQGGDITRGIYKWTEQAEAKSKLHRSKSFD
HSRPEPETEVLDINSIKVPGGFRRNHLRRNAMSPSRHADTVESGVESPSGARPPLFTSSFLEFLTIYGHFAGEEL
EEDDEALGPNEEFWSGEDRSDEDSADEREPMEDSALLPPSKKRRRRKPRGGSGKNSPLNAALLLLKSFVGTGVLF
LPRAYLSGGMMLSNLVLLCLACLSYYSFVLLVSTRMRVDGSFGDMGGILYGKWMRTLILASIVISQIGFTAAYTV
FTAENLQAFIRAVSDCRTSISIPWLILMQTVIFLPFSLLRDIGKLGFTALIADAFILIGLAYLFYYDVLTLYTNG
LADIIMFNEKDWTLFIGTAIFTFEGIGLVLPIQESMKHPQKFPRVLFLVMIIITVVFITMGAISYAAYGSKTETV
VLLNLPQDNKLVNGVQLLYSVAILLSTPLQIFPAVRIVETELFTRSGKYNPYIKWQKNIFRFFVVMLCAAISWGG
ADNLDKFVALVGNFACIPLVYIYPPLLHYKAVARNRAWKVADIVLCIFGFFAMAYATSLTIMSWANAGAKPPGYC
ERRHL*
Coding >Hirsu2|10204
ATGTCCTCGCCCAGGAACACCCTGAACCCCCCGCCGGGGCCTGCGTCGCCGGCACCGGGACAGTCGCGCTCCTTC
TCCTCCTCTCTCCCACGCGAGGAATTGACAGCTCGCCTTGCCGAGCCGATCCCGTCGGGCAACACGCCCACCCGG
AGCCGCTCTCCGGCCCCGGCCGCCAAGGCACCCGAGACCGACACTCCCCTCGTCGGCGGCCGCTCCTACGCCCAG
GGCCCGGGCGTTTCCGCCCTGGCCGCCGCTCTGTCCGACTCGCTGGGCCAGTCGCCGCCTCGCCATGGCACCCCG
CCGGCCCGCGTCGCCTCGCCGCCGCCCAGGGCCCAGTCCCCCGTGCTTCGCGGACGCGCCGACACGCCCACCAAC
TACGGCTCGCTCGACTCCAGGTCGCGGCCGGGGCCCGGGAGCGTCGTCGGCCCGTACGAAGACCCCGAGATCGTC
AAGCGGCATCTGGTCCAGCCCGGCGAATCGGAGAACCTGCCGTCCGAGGACTCGTCCACCATCGGTCCCACCCGG
GGCAAGCAGCCCGCCGAGGCGACGGCCGGCCTCAACGACGACGAGTTCTCCAGCCTGCGGCTGCAGGGGGGCGAC
ATCACCCGCGGCATCTACAAGTGGACCGAGCAGGCCGAGGCCAAGAGCAAGCTCCACCGCAGCAAGAGCTTTGAT
CACTCGCGGCCGGAGCCCGAGACGGAAGTGCTCGACATCAACTCGATCAAGGTCCCCGGCGGCTTCCGCCGGAAC
CACCTGCGCCGCAACGCCATGAGCCCGAGCCGCCACGCGGATACGGTCGAGTCGGGCGTCGAGTCCCCGTCGGGC
GCCCGGCCGCCGCTCTTCACCTCGAGCTTCCTCGAGTTCCTCACCATCTACGGCCACTTCGCCGGCGAGGAGCTC
GAGGAGGACGACGAGGCGCTCGGCCCCAACGAGGAGTTCTGGTCGGGCGAGGACCGCTCCGACGAGGACAGCGCG
GACGAGCGGGAGCCGATGGAGGACAGCGCGCTGCTCCCGCCCTCCAAGAAGAGGCGGAGACGGAAGCCCCGGGGC
GGCAGCGGCAAGAACAGCCCGCTCAACGCGGCCCTGCTGCTGCTCAAGTCGTTCGTCGGCACCGGCGTCCTCTTC
CTGCCGCGCGCGTACCTGAGCGGCGGCATGATGCTCAGCAACCTGGTGCTGCTCTGCCTCGCCTGCCTGAGCTAC
TACAGCTTCGTGCTGCTGGTGTCGACGCGCATGCGGGTCGACGGCTCCTTTGGCGACATGGGCGGCATCCTCTAC
GGCAAGTGGATGCGGACGCTCATCCTGGCGTCCATCGTCATCAGCCAGATCGGCTTCACGGCCGCCTACACCGTC
TTCACGGCCGAGAACCTGCAGGCCTTCATCCGGGCCGTGTCGGACTGCCGCACCTCGATCAGCATCCCCTGGCTG
ATCCTGATGCAGACGGTCATCTTCCTGCCCTTCTCCCTGCTGCGCGACATCGGCAAGCTCGGCTTCACGGCGCTC
ATCGCCGACGCCTTCATCCTGATCGGGCTGGCGTACCTGTTCTACTACGACGTCCTGACGCTCTACACCAACGGC
CTGGCCGACATCATCATGTTCAACGAGAAGGACTGGACGCTCTTCATCGGGACGGCCATCTTCACCTTTGAGGGC
ATCGGGCTCGTCCTGCCGATCCAGGAGTCGATGAAGCACCCGCAAAAGTTCCCGCGCGTCCTGTTCCTGGTCATG
ATCATCATCACCGTCGTCTTCATCACCATGGGCGCCATCTCGTACGCCGCGTACGGGTCCAAGACGGAGACGGTC
GTGCTGCTCAACCTGCCGCAGGACAACAAGCTGGTCAACGGCGTGCAGCTGCTGTACTCGGTCGCCATCCTGCTC
TCGACGCCGCTGCAGATCTTCCCGGCCGTGCGCATCGTCGAGACGGAGCTGTTCACGCGCAGCGGCAAGTACAAC
CCCTACATCAAGTGGCAGAAGAACATCTTCCGCTTCTTCGTCGTCATGCTCTGCGCGGCCATCTCGTGGGGCGGG
GCCGACAACCTGGACAAGTTTGTCGCCCTCGTCGGCAACTTCGCCTGCATCCCGCTCGTCTACATCTACCCGCCC
CTGCTGCACTACAAGGCCGTCGCGCGGAACCGAGCCTGGAAGGTGGCGGACATTGTGCTCTGCATATTCGGCTTC
TTCGCCATGGCCTACGCCACCAGCCTGACCATCATGAGCTGGGCCAACGCGGGCGCCAAGCCGCCCGGCTATTGC
GAGAGGAGGCATCTCTAG
Transcript >Hirsu2|10204
ATGTCCTCGCCCAGGAACACCCTGAACCCCCCGCCGGGGCCTGCGTCGCCGGCACCGGGACAGTCGCGCTCCTTC
TCCTCCTCTCTCCCACGCGAGGAATTGACAGCTCGCCTTGCCGAGCCGATCCCGTCGGGCAACACGCCCACCCGG
AGCCGCTCTCCGGCCCCGGCCGCCAAGGCACCCGAGACCGACACTCCCCTCGTCGGCGGCCGCTCCTACGCCCAG
GGCCCGGGCGTTTCCGCCCTGGCCGCCGCTCTGTCCGACTCGCTGGGCCAGTCGCCGCCTCGCCATGGCACCCCG
CCGGCCCGCGTCGCCTCGCCGCCGCCCAGGGCCCAGTCCCCCGTGCTTCGCGGACGCGCCGACACGCCCACCAAC
TACGGCTCGCTCGACTCCAGGTCGCGGCCGGGGCCCGGGAGCGTCGTCGGCCCGTACGAAGACCCCGAGATCGTC
AAGCGGCATCTGGTCCAGCCCGGCGAATCGGAGAACCTGCCGTCCGAGGACTCGTCCACCATCGGTCCCACCCGG
GGCAAGCAGCCCGCCGAGGCGACGGCCGGCCTCAACGACGACGAGTTCTCCAGCCTGCGGCTGCAGGGGGGCGAC
ATCACCCGCGGCATCTACAAGTGGACCGAGCAGGCCGAGGCCAAGAGCAAGCTCCACCGCAGCAAGAGCTTTGAT
CACTCGCGGCCGGAGCCCGAGACGGAAGTGCTCGACATCAACTCGATCAAGGTCCCCGGCGGCTTCCGCCGGAAC
CACCTGCGCCGCAACGCCATGAGCCCGAGCCGCCACGCGGATACGGTCGAGTCGGGCGTCGAGTCCCCGTCGGGC
GCCCGGCCGCCGCTCTTCACCTCGAGCTTCCTCGAGTTCCTCACCATCTACGGCCACTTCGCCGGCGAGGAGCTC
GAGGAGGACGACGAGGCGCTCGGCCCCAACGAGGAGTTCTGGTCGGGCGAGGACCGCTCCGACGAGGACAGCGCG
GACGAGCGGGAGCCGATGGAGGACAGCGCGCTGCTCCCGCCCTCCAAGAAGAGGCGGAGACGGAAGCCCCGGGGC
GGCAGCGGCAAGAACAGCCCGCTCAACGCGGCCCTGCTGCTGCTCAAGTCGTTCGTCGGCACCGGCGTCCTCTTC
CTGCCGCGCGCGTACCTGAGCGGCGGCATGATGCTCAGCAACCTGGTGCTGCTCTGCCTCGCCTGCCTGAGCTAC
TACAGCTTCGTGCTGCTGGTGTCGACGCGCATGCGGGTCGACGGCTCCTTTGGCGACATGGGCGGCATCCTCTAC
GGCAAGTGGATGCGGACGCTCATCCTGGCGTCCATCGTCATCAGCCAGATCGGCTTCACGGCCGCCTACACCGTC
TTCACGGCCGAGAACCTGCAGGCCTTCATCCGGGCCGTGTCGGACTGCCGCACCTCGATCAGCATCCCCTGGCTG
ATCCTGATGCAGACGGTCATCTTCCTGCCCTTCTCCCTGCTGCGCGACATCGGCAAGCTCGGCTTCACGGCGCTC
ATCGCCGACGCCTTCATCCTGATCGGGCTGGCGTACCTGTTCTACTACGACGTCCTGACGCTCTACACCAACGGC
CTGGCCGACATCATCATGTTCAACGAGAAGGACTGGACGCTCTTCATCGGGACGGCCATCTTCACCTTTGAGGGC
ATCGGGCTCGTCCTGCCGATCCAGGAGTCGATGAAGCACCCGCAAAAGTTCCCGCGCGTCCTGTTCCTGGTCATG
ATCATCATCACCGTCGTCTTCATCACCATGGGCGCCATCTCGTACGCCGCGTACGGGTCCAAGACGGAGACGGTC
GTGCTGCTCAACCTGCCGCAGGACAACAAGCTGGTCAACGGCGTGCAGCTGCTGTACTCGGTCGCCATCCTGCTC
TCGACGCCGCTGCAGATCTTCCCGGCCGTGCGCATCGTCGAGACGGAGCTGTTCACGCGCAGCGGCAAGTACAAC
CCCTACATCAAGTGGCAGAAGAACATCTTCCGCTTCTTCGTCGTCATGCTCTGCGCGGCCATCTCGTGGGGCGGG
GCCGACAACCTGGACAAGTTTGTCGCCCTCGTCGGCAACTTCGCCTGCATCCCGCTCGTCTACATCTACCCGCCC
CTGCTGCACTACAAGGCCGTCGCGCGGAACCGAGCCTGGAAGGTGGCGGACATTGTGCTCTGCATATTCGGCTTC
TTCGCCATGGCCTACGCCACCAGCCTGACCATCATGAGCTGGGCCAACGCGGGCGCCAAGCCGCCCGGCTATTGC
GAGAGGAGGCATCTCTAG
Gene >Hirsu2|10204
ATGTCCTCGCCCAGGAACACCCTGAACCCCCCGCCGGGGCCTGCGTCGCCGGCACCGGGACAGTCGCGCTCCTTC
TCCTCCTCTCTCCCACGCGAGGAATTGACAGCTCGCCTTGCCGAGCCGATCCCGTCGGGCAACACGCCCACCCGG
AGCCGCTCTCCGGCCCCGGCCGCCAAGGCACCCGAGACCGACACTCCCCTCGTCGGCGGCCGCTCCTACGCCCAG
GGCCCGGGCGTTTCCGCCCTGGCCGCCGCTCTGTCCGACTCGCTGGGCCAGTCGCCGCCTCGCCATGGCACCCCG
CCGGCCCGCGTCGCCTCGCCGCCGCCCAGGGCCCAGTCCCCCGTGCTTCGCGGACGCGCCGACACGCCCACCAAC
TACGGCTCGCTCGACTCCAGGTCGCGGCCGGGGCCCGGGAGCGTCGTCGGCCCGTACGAAGACCCCGAGATCGTC
AAGCGGCATCTGGTCCAGCCCGGCGAATCGGAGAACCTGCCGTCCGAGGACTCGTCCACCATCGGTCCCACCCGG
GGCAAGCAGCCCGCCGAGGCGACGGCCGGCCTCAACGACGACGAGTTCTCCAGCCTGCGGCTGCAGGGGGGCGAC
ATCACCCGCGGCATCTACAAGTGGACCGAGCAGGCCGAGGCCAAGAGCAAGCTCCACCGCAGCAAGAGCTTTGAT
CACTCGCGGCCGGAGCCCGAGACGGAAGTGCTCGACATCAACTCGATCAAGGTCCCCGGCGGCTTCCGCCGGAAC
CACCTGCGCCGCAACGCCATGAGCCCGAGCCGCCACGCGGATACGGTCGAGTCGGGCGTCGAGTCCCCGTCGGGC
GCCCGGCCGCCGCTCTTCACCTCGAGCTTCCTCGAGTTCCTCACCATCTACGGCCACTTCGCCGGCGAGGAGCTC
GAGGAGGACGACGAGGCGCTCGGCCCCAACGAGGAGTTCTGGTCGGGCGAGGACCGCTCCGACGAGGACAGCGCG
GACGAGCGGGAGCCGATGGAGGACAGCGCGCTGCTCCCGCCCTCCAAGAAGAGGCGGAGACGGAAGCCCCGGGGC
GGCAGCGGCAAGAACAGCCCGCTCAACGCGGCCCTGCTGCTGCTCAAGTCGTTCGTCGGCACCGGCGTCCTCTTC
CTGCCGCGCGCGTACCTGAGCGGCGGCATGATGCTCAGCAACCTGGTGCTGCTCTGCCTCGCCTGCCTGAGCTAC
TACAGCTTCGTGCTGCTGGTGTCGACGCGCATGCGGGTCGACGGCTCCTTTGGCGACATGGGCGGCATCCTCTAC
GGCAAGTGGATGCGGACGCTCATCCTGGCGTCCATCGTCATCAGCCAGATCGGCTTCACGGCCGCCTACACCGTC
TTCACGGCCGAGAACCTGCAGGCCTTCATCCGGGCCGTGTCGGACTGCCGCACCTCGATCAGCATCCCCTGGCTG
ATCCTGATGCAGACGGTCATCTTCCTGCCCTTCTCCCTGCTGCGCGACATCGGCAAGCTCGGCTTCACGGCGCTC
ATCGCCGACGCCTTCATCCTGATCGGGCTGGCGTACCTGTTCTACTACGACGTCCTGACGCTCTACACCAACGGC
CTGGCCGACATCATCATGTTCAACGAGAAGGACTGGACGCTCTTCATCGGGACGGCCATCTTCACCTTTGAGGGC
ATCGGGCTCGTCCTGCCGATCCAGGAGTCGATGAAGCACCCGCAAAAGTTCCCGCGCGTCCTGTTCCTGGTCATG
ATCATCATCACCGTCGTCTTCATCACCATGGGCGCCATCTCGTACGCCGCGTACGGGTCCAAGACGGAGACGGTC
GTGCTGCTCAACCTGCCGCAGGACAACAAGCTGGTCAACGGCGTGCAGCTGCTGTACTCGGTCGCCATCCTGCTC
TCGACGCCGCTGCAGATCTTCCCGGCCGTGCGCATCGTCGAGACGGAGCTGTTCACGCGCAGCGGCAAGTACAAC
CCCTACATCAAGTGGCAGAAGAACATCTTCCGCTTCTTCGTCGTCATGCTCTGCGCGGCCATCTCGTGGGGCGGG
GCCGACAACCTGGACAAGTTTGTCGCCCTCGTCGGCAACTTCGCCTGCATCCCGCTCGTCTACATCTACCCGGTA
AGTCATCCGCGCCCCGTCCGCCGACGCGGTCCGCTAACACGGCCGGCAAGCCCCTGCTGCACTACAAGGCCGTCG
CGCGGAACCGAGCCTGGAAGGTGGCGGACATTGTGCTCTGCATATTCGGCTTCTTCGCCATGGCCTACGCCACCA
GCCTGACCATCATGAGCTGGGCCAACGCGGGCGCCAAGCCGCCCGGCTATTGCGAGAGGAGGCATCTCTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail