Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10203
Gene name
LocationContig_800:9278..11748
Strand+
Gene length (bp)2470
Transcript length (bp)2319
Coding sequence length (bp)2319
Protein length (aa) 773

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09359 VTC VTC domain 5.4E-98 205 478
PF02656 DUF202 Domain of unknown function (DUF202) 1.1E-11 667 731

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P78810|VTC4_SCHPO Vacuolar transporter chaperone 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vtc4 PE=1 SV=2 1 761 0.0E+00
sp|P47075|VTC4_YEAST Vacuolar transporter chaperone 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VTC4 PE=1 SV=2 1 762 0.0E+00
sp|O13718|VTC2_SCHPO Vacuolar transporter chaperone 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vtc2 PE=1 SV=1 1 764 2.0E-97
sp|Q02725|VTC3_YEAST Vacuolar transporter chaperone 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VTC3 PE=1 SV=1 1 498 2.0E-68
sp|P43585|VTC2_YEAST Vacuolar transporter chaperone 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VTC2 PE=1 SV=1 1 498 2.0E-67
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P78810|VTC4_SCHPO Vacuolar transporter chaperone 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vtc4 PE=1 SV=2 1 761 0.0E+00
sp|P47075|VTC4_YEAST Vacuolar transporter chaperone 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VTC4 PE=1 SV=2 1 762 0.0E+00
sp|O13718|VTC2_SCHPO Vacuolar transporter chaperone 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vtc2 PE=1 SV=1 1 764 2.0E-97
sp|Q02725|VTC3_YEAST Vacuolar transporter chaperone 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VTC3 PE=1 SV=1 1 498 2.0E-68
sp|P43585|VTC2_YEAST Vacuolar transporter chaperone 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VTC2 PE=1 SV=1 1 498 2.0E-67
sp|Q9UR17|VTC1_SCHPO Vacuolar transporter chaperone 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nrf1 PE=2 SV=1 647 764 1.0E-27
sp|P40046|VTC1_YEAST Vacuolar transporter chaperone 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VTC1 PE=1 SV=3 655 762 3.0E-22
sp|Q5PP62|SPX3_ARATH SPX domain-containing protein 3 OS=Arabidopsis thaliana GN=SPX3 PE=2 SV=1 1 205 7.0E-08
sp|Q7Y0F6|SPX5_ORYSJ SPX domain-containing protein 5 OS=Oryza sativa subsp. japonica GN=SPX5 PE=2 SV=1 1 176 6.0E-07
sp|A2XHU0|SPX5_ORYSI SPX domain-containing protein 5 OS=Oryza sativa subsp. indica GN=SPX5 PE=3 SV=1 1 176 6.0E-07
sp|O59712|YBH4_SCHPO Uncharacterized transporter C3B8.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3B8.04c PE=3 SV=1 99 165 7.0E-07
sp|Q8LBH4|SPX1_ARATH SPX domain-containing protein 1 OS=Arabidopsis thaliana GN=SPX1 PE=2 SV=2 1 178 1.0E-06
sp|Q6Z784|SPX2_ORYSJ SPX domain-containing protein 2 OS=Oryza sativa subsp. japonica GN=SPX2 PE=2 SV=1 1 176 2.0E-06
sp|A2X254|SPX2_ORYSI SPX domain-containing protein 2 OS=Oryza sativa subsp. indica GN=SPX2 PE=3 SV=1 1 176 2.0E-06
sp|Q7XEY9|SPX3_ORYSJ SPX domain-containing protein 3 OS=Oryza sativa subsp. japonica GN=SPX3 PE=2 SV=1 1 176 2.0E-06
sp|A2Z6W1|SPX3_ORYSI SPX domain-containing protein 3 OS=Oryza sativa subsp. indica GN=SPX3 PE=3 SV=1 1 176 2.0E-06
sp|Q94A21|SPX4_ARATH SPX domain-containing protein 4 OS=Arabidopsis thaliana GN=SPX4 PE=2 SV=1 27 166 5.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 62 0.45

Transmembrane Domains

Domain # Start End Length
1 676 698 22
2 705 727 22
3 745 764 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10203
MKFGEQLRSSVIREYQWYYIDYNGLKADLKKATGPLKAGGILGREWTEEDETRFVGKLEDELEKVHTKQQVKAME
ISRRIAVSEREVREVVNRLNERGLAEDGPSEEEFQLLEEDLSDIIADVHDLAKFVQLNYTGFYKIIKKHDKMTGW
HLRPAFDTRLKAKPFYKENYDASVIKLSTLYDLVRTRGNPVKGDSAAGGSQASFVRQTTKYWVHPDNVTELKLII
LKHLPVLVFNASKEFEQQDSAITSIYYDNPDTWDLYEGRLKKTEGAEAIRLRWYGGMQNETIFVERKTHREDWTG
EKSVKARFSIKEKNVNAYLRGELLPPAIFEKARKEGKKSEKAIAEDERLASEIQYSVLKKGYRPVCRSFYNRTAF
QLPADARVRISLDTELSMIREDNLDGRLRSGDNWRRMDIGIDYPFSQLPPDDIVRFPYAVLEVKLQTQLGQEPPA
WVRQLISSHLVEAVPKFSKFIHGTACLFPDRIGLLPFWMPQMDVDIRKPVAHDFGIHRPGISGGTTTTSEDEEDL
DSDDEDERPGRPSPSNGQSAGHAQGLPGAAADAEDQTAASAAPNEDYPIYDSDEEYDENYELEEARRIGGWHYYS
TLISAKARALGRGALGVAKFLAPAPRSTQIPASQRQHALFGPGAVQQKKFKAPKGKKIYVPVRVEPKVYLAAERT
FLGWLEFSIYIGAIAVTLLNFGTRTTSPSFWTAGIFTLLAVLSLCYSVAIYLYRSRSIRRRKAARYYDKWGPSGL
CAALFVAVALNFAFEGRRRGIW*
Coding >Hirsu2|10203
ATGAAGTTTGGCGAGCAGCTCCGGTCGAGCGTGATTCGCGAGTACCAATGGTACTACATTGACTACAACGGCCTC
AAGGCCGACCTCAAGAAGGCCACCGGCCCGCTCAAAGCCGGCGGCATTCTCGGCCGGGAATGGACCGAGGAGGAC
GAGACGCGCTTCGTGGGCAAGCTCGAGGACGAGCTGGAAAAGGTGCACACCAAGCAGCAGGTCAAGGCCATGGAG
ATCTCGAGGCGCATCGCCGTCAGCGAGCGCGAGGTCAGGGAGGTCGTCAACCGGCTCAACGAGCGCGGCCTGGCC
GAGGACGGGCCCAGCGAGGAGGAGTTCCAGCTGCTGGAGGAGGACCTCAGCGACATCATCGCCGACGTCCACGAC
CTGGCCAAGTTCGTCCAGCTCAACTACACCGGCTTCTACAAGATCATCAAGAAACACGATAAAATGACGGGCTGG
CACCTCCGCCCGGCCTTCGACACCCGCCTCAAGGCCAAGCCCTTCTACAAGGAGAACTACGACGCGTCCGTCATC
AAGCTGTCGACGCTCTACGACCTCGTCCGCACCCGCGGCAACCCGGTCAAGGGCGACAGCGCCGCCGGCGGCTCC
CAGGCCAGCTTCGTCCGGCAGACGACCAAGTACTGGGTCCACCCGGACAACGTGACGGAGCTGAAGCTCATCATC
CTCAAGCACCTGCCCGTCCTCGTCTTCAACGCGAGCAAGGAGTTCGAGCAGCAGGACTCGGCCATCACCTCCATC
TACTACGACAACCCCGACACCTGGGACCTGTACGAGGGCCGGCTGAAGAAGACGGAGGGCGCCGAGGCCATCCGC
CTCCGCTGGTACGGCGGCATGCAGAACGAGACCATCTTCGTCGAGCGCAAGACGCACCGCGAGGACTGGACCGGC
GAGAAGTCGGTCAAGGCCCGCTTCTCCATCAAGGAGAAGAACGTCAACGCCTACCTGAGGGGCGAGCTGCTGCCG
CCCGCCATCTTCGAGAAGGCGCGCAAGGAGGGCAAGAAGTCGGAAAAGGCCATCGCCGAGGACGAGAGGCTGGCG
TCCGAGATCCAGTACTCGGTCCTCAAGAAGGGCTACCGGCCCGTCTGCCGCTCCTTCTACAACCGGACCGCCTTT
CAGCTGCCGGCCGACGCCCGCGTCCGCATCTCCCTCGACACCGAGCTGTCCATGATCCGCGAGGACAACCTCGAC
GGCCGCCTCCGGTCCGGCGACAACTGGCGCCGCATGGACATCGGCATCGACTACCCCTTTTCGCAGCTGCCGCCC
GACGACATCGTGCGCTTCCCCTACGCCGTCCTCGAGGTCAAGCTGCAGACGCAGCTGGGACAGGAGCCCCCGGCC
TGGGTCCGCCAGCTCATCTCGTCGCACCTGGTCGAGGCCGTGCCCAAGTTCTCCAAGTTCATCCACGGCACGGCC
TGCCTGTTCCCCGACCGCATCGGCCTGCTGCCCTTCTGGATGCCGCAGATGGACGTCGACATCCGGAAGCCCGTC
GCCCACGACTTCGGCATCCACCGGCCCGGCATCTCGGGCGGGACGACGACGACGTCGGAGGACGAGGAGGACCTG
GACTCGGACGACGAAGACGAGCGGCCGGGCCGCCCGAGCCCCTCCAACGGCCAGTCCGCCGGTCACGCCCAGGGG
CTGCCCGGCGCGGCCGCCGACGCCGAGGACCAGACGGCCGCGTCCGCCGCGCCCAACGAGGATTACCCCATCTAC
GACTCGGACGAGGAATACGACGAGAACTACGAGCTGGAGGAGGCCAGGAGGATCGGCGGCTGGCACTACTACTCG
ACGCTCATCTCGGCCAAGGCCCGCGCCTTGGGCCGCGGCGCCCTCGGCGTGGCCAAGTTCCTGGCGCCGGCGCCT
CGCAGCACGCAGATCCCGGCCAGCCAGCGGCAGCACGCCCTGTTCGGCCCCGGCGCCGTCCAGCAGAAGAAGTTC
AAGGCGCCCAAGGGCAAGAAGATCTACGTGCCGGTCCGCGTCGAGCCCAAGGTCTACCTGGCCGCGGAGAGGACC
TTTTTGGGTTGGCTCGAGTTCTCCATCTACATCGGGGCCATCGCCGTCACGCTGCTCAACTTCGGGACCAGGACG
ACGTCGCCGTCGTTCTGGACGGCCGGCATCTTCACGCTGCTCGCCGTGCTCAGCCTGTGCTACTCGGTCGCCATC
TACCTGTACCGCAGCCGGTCGATCCGGCGCCGCAAGGCGGCGCGCTACTACGACAAGTGGGGGCCCAGCGGCCTC
TGCGCCGCCCTCTTCGTCGCCGTCGCCCTCAACTTTGCCTTTGAGGGCCGCCGACGGGGCATCTGGTGA
Transcript >Hirsu2|10203
ATGAAGTTTGGCGAGCAGCTCCGGTCGAGCGTGATTCGCGAGTACCAATGGTACTACATTGACTACAACGGCCTC
AAGGCCGACCTCAAGAAGGCCACCGGCCCGCTCAAAGCCGGCGGCATTCTCGGCCGGGAATGGACCGAGGAGGAC
GAGACGCGCTTCGTGGGCAAGCTCGAGGACGAGCTGGAAAAGGTGCACACCAAGCAGCAGGTCAAGGCCATGGAG
ATCTCGAGGCGCATCGCCGTCAGCGAGCGCGAGGTCAGGGAGGTCGTCAACCGGCTCAACGAGCGCGGCCTGGCC
GAGGACGGGCCCAGCGAGGAGGAGTTCCAGCTGCTGGAGGAGGACCTCAGCGACATCATCGCCGACGTCCACGAC
CTGGCCAAGTTCGTCCAGCTCAACTACACCGGCTTCTACAAGATCATCAAGAAACACGATAAAATGACGGGCTGG
CACCTCCGCCCGGCCTTCGACACCCGCCTCAAGGCCAAGCCCTTCTACAAGGAGAACTACGACGCGTCCGTCATC
AAGCTGTCGACGCTCTACGACCTCGTCCGCACCCGCGGCAACCCGGTCAAGGGCGACAGCGCCGCCGGCGGCTCC
CAGGCCAGCTTCGTCCGGCAGACGACCAAGTACTGGGTCCACCCGGACAACGTGACGGAGCTGAAGCTCATCATC
CTCAAGCACCTGCCCGTCCTCGTCTTCAACGCGAGCAAGGAGTTCGAGCAGCAGGACTCGGCCATCACCTCCATC
TACTACGACAACCCCGACACCTGGGACCTGTACGAGGGCCGGCTGAAGAAGACGGAGGGCGCCGAGGCCATCCGC
CTCCGCTGGTACGGCGGCATGCAGAACGAGACCATCTTCGTCGAGCGCAAGACGCACCGCGAGGACTGGACCGGC
GAGAAGTCGGTCAAGGCCCGCTTCTCCATCAAGGAGAAGAACGTCAACGCCTACCTGAGGGGCGAGCTGCTGCCG
CCCGCCATCTTCGAGAAGGCGCGCAAGGAGGGCAAGAAGTCGGAAAAGGCCATCGCCGAGGACGAGAGGCTGGCG
TCCGAGATCCAGTACTCGGTCCTCAAGAAGGGCTACCGGCCCGTCTGCCGCTCCTTCTACAACCGGACCGCCTTT
CAGCTGCCGGCCGACGCCCGCGTCCGCATCTCCCTCGACACCGAGCTGTCCATGATCCGCGAGGACAACCTCGAC
GGCCGCCTCCGGTCCGGCGACAACTGGCGCCGCATGGACATCGGCATCGACTACCCCTTTTCGCAGCTGCCGCCC
GACGACATCGTGCGCTTCCCCTACGCCGTCCTCGAGGTCAAGCTGCAGACGCAGCTGGGACAGGAGCCCCCGGCC
TGGGTCCGCCAGCTCATCTCGTCGCACCTGGTCGAGGCCGTGCCCAAGTTCTCCAAGTTCATCCACGGCACGGCC
TGCCTGTTCCCCGACCGCATCGGCCTGCTGCCCTTCTGGATGCCGCAGATGGACGTCGACATCCGGAAGCCCGTC
GCCCACGACTTCGGCATCCACCGGCCCGGCATCTCGGGCGGGACGACGACGACGTCGGAGGACGAGGAGGACCTG
GACTCGGACGACGAAGACGAGCGGCCGGGCCGCCCGAGCCCCTCCAACGGCCAGTCCGCCGGTCACGCCCAGGGG
CTGCCCGGCGCGGCCGCCGACGCCGAGGACCAGACGGCCGCGTCCGCCGCGCCCAACGAGGATTACCCCATCTAC
GACTCGGACGAGGAATACGACGAGAACTACGAGCTGGAGGAGGCCAGGAGGATCGGCGGCTGGCACTACTACTCG
ACGCTCATCTCGGCCAAGGCCCGCGCCTTGGGCCGCGGCGCCCTCGGCGTGGCCAAGTTCCTGGCGCCGGCGCCT
CGCAGCACGCAGATCCCGGCCAGCCAGCGGCAGCACGCCCTGTTCGGCCCCGGCGCCGTCCAGCAGAAGAAGTTC
AAGGCGCCCAAGGGCAAGAAGATCTACGTGCCGGTCCGCGTCGAGCCCAAGGTCTACCTGGCCGCGGAGAGGACC
TTTTTGGGTTGGCTCGAGTTCTCCATCTACATCGGGGCCATCGCCGTCACGCTGCTCAACTTCGGGACCAGGACG
ACGTCGCCGTCGTTCTGGACGGCCGGCATCTTCACGCTGCTCGCCGTGCTCAGCCTGTGCTACTCGGTCGCCATC
TACCTGTACCGCAGCCGGTCGATCCGGCGCCGCAAGGCGGCGCGCTACTACGACAAGTGGGGGCCCAGCGGCCTC
TGCGCCGCCCTCTTCGTCGCCGTCGCCCTCAACTTTGCCTTTGAGGGCCGCCGACGGGGCATCTGGTGA
Gene >Hirsu2|10203
ATGAAGTTTGGCGAGCAGCTCCGGTCGAGCGTGATTCGCGAGTACCAATGGTACTACATTGACTACAACGGCCTC
AAGGCCGACCTCAAGAAGGCCACCGGCCCGCTCAAAGCCGGCGGCATTCTCGGCCGGGAATGGACCGAGGAGGAC
GAGACGCGCTTCGTGGGCAAGCTCGAGGACGAGCTGGAAAAGGTGCACACCAAGCAGCAGGTCAAGGCCATGGAG
ATCTCGAGGCGCATCGCCGTCAGCGAGCGCGAGGTCAGGGAGGTCGTCAACCGGCTCAACGAGCGCGGCCTGGCC
GAGGACGGGCCCAGCGAGGAGGAGTTCCAGCTGCTGGAGGAGGACCTCAGCGACATCATCGCCGACGTCCACGAC
CTGGCCAAGTTCGTCCAGCTCAACTACACCGGCTTCTACAAGATCATCAAGAAACACGATGTGAGTGGCGACGAC
GCCGCGCCGGCACCGACACTGACAAGCACGCGGCGTAGAAAATGACGGGCTGGCACCTCCGCCCGGCCTTCGACA
CCCGCCTCAAGGCCAAGCCCTTCTACAAGGAGAACTACGACGCGTCCGTCATCAAGCTGTCGACGCTCTACGACC
TCGTCCGCACCCGCGGCAACCCGGTCAAGGGCGACAGCGCCGCCGGCGGCTCCCAGGCCAGCTTCGTCCGGCAGA
CGACCAAGTACTGGGTCCACCCGGACAACGTGACGGAGCTGAAGCTCATCATCCTCAAGCACCTGCCCGTCCTCG
TCTTCAACGCGAGCAAGGAGTTCGAGCAGCAGGACTCGGCCATCACCTCCATCTACTACGACAACCCCGACACCT
GGGACCTGTACGAGGGCCGGCTGAAGAAGACGGAGGGCGCCGAGGCCATCCGCCTCCGCTGGTACGGCGGCATGC
AGAACGAGACCATCTTCGTCGAGCGCAAGACGCACCGCGAGGACTGGACCGGCGAGAAGTCGGTCAAGGCCCGCT
TCTCCATCAAGGAGAAGAACGTCAACGCCTACCTGAGGGGCGAGCTGCTGCCGCCCGCCATCTTCGAGAAGGCGC
GCAAGGAGGGCAAGAAGTCGGAAAAGGCCATCGCCGAGGACGAGAGGCTGGCGTCCGAGATCCAGTACTCGGTCC
TCAAGAAGGGCTACCGGCCCGTCTGCCGCTCCTTCTACAACCGGACCGCCTTTCAGCTGCCGGCCGACGCCCGCG
TCCGCATCTCCCTCGACACCGAGCTGTCCATGATCCGCGAGGACAACCTCGACGGCCGCCTCCGGTCCGGCGACA
ACTGGCGCCGCATGGACATCGGCATCGACTACCCCTTTTCGCAGCTGCCGCCCGACGACATCGTGCGCTTCCCCT
ACGCCGTCCTCGAGGTCAAGCTGCAGACGCAGCTGGGACAGGAGCCCCCGGCCTGGGTCCGCCAGCTCATCTCGT
CGCACCTGGTCGAGGCCGTGCCCAAGTTCTCCAAGTTCATCCACGGCACGGCCTGCCTGTTCCCCGACCGCATCG
GCCTGCTGCCCTTCTGGATGCCGCAGATGGACGTCGACATCCGGAAGCCCGTCGCCCACGACTTCGGCATCCACC
GGCCCGGCATCTCGGGCGGGACGACGACGACGTCGGAGGACGAGGAGGACCTGGACTCGGACGACGAAGACGAGC
GGCCGGGCCGCCCGAGCCCCTCCAACGGCCAGTCCGCCGGTCACGCCCAGGGGCTGCCCGGCGCGGCCGCCGACG
CCGAGGACCAGACGGCCGCGTCCGCCGCGCCCAACGAGGATTACCCCATCTACGACTCGGACGAGGAATACGACG
AGAACTACGAGCTGGAGGAGGCCAGGAGGATCGGCGGCTGGCACTACTACTCGACGCTCATCTCGGCCAAGGCCC
GCGCCTTGGGCCGCGGCGCCCTCGGCGTGGCCAAGTTCCTGGCGCCGGCGCCTCGCAGCACGCAGATCCCGGCCA
GCCAGCGGCAGCACGCCCTGTTCGGCCCCGGCGCCGTCCAGCAGAAGAAGTTCAAGGCGCCCAAGGGCAAGAAGA
TCTACGTGCCGGTCCGCGTCGAGCCCAAGGTCTACCTGGCCGCGGAGAGGACCTTTTTGGGTTGGGTAAGTCCGG
GGTCCCGTCCCTGTCGCAGCTCGAGAGAGAGAGAGAGAGAAAGGACGGAGACGGGCGGCTGACACGACATGTTTT
GTCCCTGCCGCAGCTCGAGTTCTCCATCTACATCGGGGCCATCGCCGTCACGCTGCTCAACTTCGGGACCAGGAC
GACGTCGCCGTCGTTCTGGACGGCCGGCATCTTCACGCTGCTCGCCGTGCTCAGCCTGTGCTACTCGGTCGCCAT
CTACCTGTACCGCAGCCGGTCGATCCGGCGCCGCAAGGCGGCGCGCTACTACGACAAGTGGGGGCCCAGCGGCCT
CTGCGCCGCCCTCTTCGTCGCCGTCGCCCTCAACTTTGCCTTTGAGGGCCGCCGACGGGGCATCTGGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail