Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10200
Gene name
LocationContig_800:1395..3002
Strand-
Gene length (bp)1607
Transcript length (bp)1482
Coding sequence length (bp)1482
Protein length (aa) 494

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04597 Ribophorin_I Ribophorin I 5.6E-150 43 483

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q91YQ5|RPN1_MOUSE Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Mus musculus GN=Rpn1 PE=1 SV=1 120 477 3.0E-50
sp|Q5RFB6|RPN1_PONAB Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Pongo abelii GN=RPN1 PE=2 SV=1 120 477 5.0E-50
sp|P04843|RPN1_HUMAN Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Homo sapiens GN=RPN1 PE=1 SV=1 120 477 2.0E-49
sp|Q4R4T0|RPN1_MACFA Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Macaca fascicularis GN=RPN1 PE=2 SV=1 120 477 3.0E-49
sp|P41543|OST1_YEAST Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OST1 PE=1 SV=1 30 489 2.0E-48
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q91YQ5|RPN1_MOUSE Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Mus musculus GN=Rpn1 PE=1 SV=1 120 477 3.0E-50
sp|Q5RFB6|RPN1_PONAB Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Pongo abelii GN=RPN1 PE=2 SV=1 120 477 5.0E-50
sp|P04843|RPN1_HUMAN Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Homo sapiens GN=RPN1 PE=1 SV=1 120 477 2.0E-49
sp|Q4R4T0|RPN1_MACFA Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Macaca fascicularis GN=RPN1 PE=2 SV=1 120 477 3.0E-49
sp|P41543|OST1_YEAST Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OST1 PE=1 SV=1 30 489 2.0E-48
sp|Q9GMB0|RPN1_PIG Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Sus scrofa GN=RPN1 PE=1 SV=1 120 477 3.0E-48
sp|P07153|RPN1_RAT Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Rattus norvegicus GN=Rpn1 PE=2 SV=1 120 477 5.0E-48
sp|Q9ZUA0|OST1B_ARATH Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1B OS=Arabidopsis thaliana GN=OST1B PE=2 SV=1 37 493 2.0E-47
sp|Q54C27|OST1_DICDI Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Dictyostelium discoideum GN=ost1 PE=2 SV=1 41 475 2.0E-46
sp|Q10176|OST1_SCHPO Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ost1 PE=3 SV=1 41 462 1.0E-45
sp|B9FDT1|OST1B_ORYSJ Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1B OS=Oryza sativa subsp. japonica GN=OST1B PE=2 SV=1 19 482 2.0E-44
sp|Q9GZH4|RPN1_CAEEL Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Caenorhabditis elegans GN=ribo-1 PE=3 SV=2 43 466 1.0E-42
sp|Q9SFX3|OST1A_ARATH Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1A OS=Arabidopsis thaliana GN=OST1A PE=2 SV=1 115 492 1.0E-40
sp|Q0DJC5|OST1A_ORYSJ Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1A OS=Oryza sativa subsp. japonica GN=OST1A PE=2 SV=1 52 492 6.0E-40
[Show less]

GO

GO Term Description Terminal node
GO:0006486 protein glycosylation Yes
GO:0016021 integral component of membrane Yes
GO:0005783 endoplasmic reticulum Yes
GO:0004579 dolichyl-diphosphooligosaccharide-protein glycotransferase activity Yes
GO:0006464 cellular protein modification process No
GO:0043227 membrane-bounded organelle No
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:0044424 intracellular part No
GO:0016758 transferase activity, transferring hexosyl groups No
GO:0003824 catalytic activity No
GO:0016757 transferase activity, transferring glycosyl groups No
GO:0019538 protein metabolic process No
GO:0044444 cytoplasmic part No
GO:0044464 cell part No
GO:0043231 intracellular membrane-bounded organelle No
GO:0004576 oligosaccharyl transferase activity No
GO:0044425 membrane part No
GO:0043229 intracellular organelle No
GO:0031224 intrinsic component of membrane No
GO:0043412 macromolecule modification No
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0043413 macromolecule glycosylation No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0070085 glycosylation No
GO:0044267 cellular protein metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0044260 cellular macromolecule metabolic process No
GO:0043226 organelle No
GO:0036211 protein modification process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

Domain # Start End Length
1 468 490 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10200
MKPLSVASALLGLLASSVAASSPPQPSSAKVTQPAEFKPPQVFRNANLVHVISLEKNYVKEQINVLVENVSKKPQ
DEYYLPFTADQMARVGGFEVKDRKDANAGPFEADVVEFDPNSDVQYYRIRLPAQLKPGSQQTLGISFYYLKAYSP
LPASIKQDETQFLSYDFSAYATSAYPTSKQKTEIKAPSSSIPDYTNMAGKDGKEQHPQKQGAKLTYGPFDSEVPA
GAASPANVRVEFTKPVTHVSSLERDIEVSHWGGNVAFEERYTLYNRGANLSVPFNRVKFAQSQYFNPSSFALKEM
RFPLQVGSLDPYFTDTIGNVSTSKFRSSKREALLELKPRYPIFGGWKYPFTIGWNANAAGLLRKTAAGGYVLKVP
FMEGPKQAEGIEYAQVNVRVLLPEGASNVKVQTGIPASSLVESSVGVHKTYLDTLGRTAVVVRARNLVDEFRDRD
LVIYYETSAFDLLRKPLIVFSSVLTAFAAAWAIGMVEVGFSRK*
Coding >Hirsu2|10200
ATGAAGCCGCTCTCAGTCGCTTCGGCTCTCCTGGGCCTGCTGGCCTCGTCCGTCGCCGCGTCCAGCCCGCCGCAG
CCATCGTCGGCCAAGGTGACGCAGCCGGCCGAGTTCAAGCCGCCGCAGGTCTTCCGCAACGCCAACCTCGTGCAC
GTCATCTCGCTCGAGAAGAACTACGTCAAGGAACAGATCAACGTGCTCGTCGAAAATGTCTCCAAGAAGCCGCAG
GACGAATACTACCTCCCCTTCACCGCCGACCAGATGGCCCGGGTTGGCGGGTTCGAGGTCAAGGATCGCAAAGAC
GCCAATGCCGGGCCTTTCGAGGCCGACGTCGTCGAATTTGATCCGAACAGTGACGTGCAATACTATCGGATCCGG
CTCCCTGCCCAGCTCAAGCCCGGCAGTCAGCAGACGCTGGGAATCTCCTTCTACTACCTAAAGGCATATAGTCCC
CTGCCGGCGTCGATCAAGCAGGACGAGACTCAGTTCCTCTCCTACGACTTCTCCGCCTATGCAACGTCCGCGTAC
CCGACCTCGAAGCAAAAGACGGAGATCAAGGCGCCCAGCTCATCCATCCCCGACTACACCAATATGGCGGGCAAG
GATGGCAAGGAGCAGCATCCGCAGAAGCAGGGCGCAAAGCTCACGTACGGGCCCTTTGACAGCGAGGTGCCGGCC
GGCGCCGCGTCCCCGGCAAACGTGCGCGTCGAGTTTACCAAGCCCGTCACGCACGTCTCCAGCCTGGAGCGCGAC
ATCGAGGTCAGCCACTGGGGCGGCAACGTCGCGTTCGAGGAACGATACACGCTGTACAACCGAGGCGCCAACCTG
TCGGTCCCGTTCAACCGGGTCAAGTTTGCGCAGTCGCAGTACTTCAACCCTTCGTCCTTCGCGCTCAAGGAGATG
CGCTTCCCGCTCCAGGTCGGCAGCCTGGACCCCTACTTCACGGATACCATCGGCAACGTGTCGACGTCCAAGTTT
AGGAGCAGCAAGCGCGAGGCCCTGCTGGAGCTCAAGCCGCGATACCCCATCTTTGGTGGCTGGAAGTACCCCTTC
ACCATTGGCTGGAACGCGAACGCGGCCGGGCTGCTGCGCAAGACGGCGGCGGGAGGCTACGTACTCAAGGTGCCC
TTCATGGAGGGGCCCAAGCAGGCCGAGGGCATCGAGTACGCACAGGTCAACGTTCGCGTCCTGCTTCCCGAAGGT
GCCTCGAACGTCAAGGTCCAGACGGGGATCCCCGCGTCATCGCTGGTCGAGTCGTCGGTCGGCGTGCACAAGACA
TACCTGGACACGCTCGGGCGCACGGCGGTGGTGGTGCGCGCGCGCAATCTGGTGGACGAGTTCCGGGACCGCGAC
CTCGTCATCTACTACGAGACATCGGCCTTTGATCTGCTGCGGAAGCCGTTGATTGTCTTCTCGAGCGTGCTGACG
GCATTTGCGGCGGCCTGGGCCATCGGCATGGTCGAGGTGGGATTTTCGAGAAAGTGA
Transcript >Hirsu2|10200
ATGAAGCCGCTCTCAGTCGCTTCGGCTCTCCTGGGCCTGCTGGCCTCGTCCGTCGCCGCGTCCAGCCCGCCGCAG
CCATCGTCGGCCAAGGTGACGCAGCCGGCCGAGTTCAAGCCGCCGCAGGTCTTCCGCAACGCCAACCTCGTGCAC
GTCATCTCGCTCGAGAAGAACTACGTCAAGGAACAGATCAACGTGCTCGTCGAAAATGTCTCCAAGAAGCCGCAG
GACGAATACTACCTCCCCTTCACCGCCGACCAGATGGCCCGGGTTGGCGGGTTCGAGGTCAAGGATCGCAAAGAC
GCCAATGCCGGGCCTTTCGAGGCCGACGTCGTCGAATTTGATCCGAACAGTGACGTGCAATACTATCGGATCCGG
CTCCCTGCCCAGCTCAAGCCCGGCAGTCAGCAGACGCTGGGAATCTCCTTCTACTACCTAAAGGCATATAGTCCC
CTGCCGGCGTCGATCAAGCAGGACGAGACTCAGTTCCTCTCCTACGACTTCTCCGCCTATGCAACGTCCGCGTAC
CCGACCTCGAAGCAAAAGACGGAGATCAAGGCGCCCAGCTCATCCATCCCCGACTACACCAATATGGCGGGCAAG
GATGGCAAGGAGCAGCATCCGCAGAAGCAGGGCGCAAAGCTCACGTACGGGCCCTTTGACAGCGAGGTGCCGGCC
GGCGCCGCGTCCCCGGCAAACGTGCGCGTCGAGTTTACCAAGCCCGTCACGCACGTCTCCAGCCTGGAGCGCGAC
ATCGAGGTCAGCCACTGGGGCGGCAACGTCGCGTTCGAGGAACGATACACGCTGTACAACCGAGGCGCCAACCTG
TCGGTCCCGTTCAACCGGGTCAAGTTTGCGCAGTCGCAGTACTTCAACCCTTCGTCCTTCGCGCTCAAGGAGATG
CGCTTCCCGCTCCAGGTCGGCAGCCTGGACCCCTACTTCACGGATACCATCGGCAACGTGTCGACGTCCAAGTTT
AGGAGCAGCAAGCGCGAGGCCCTGCTGGAGCTCAAGCCGCGATACCCCATCTTTGGTGGCTGGAAGTACCCCTTC
ACCATTGGCTGGAACGCGAACGCGGCCGGGCTGCTGCGCAAGACGGCGGCGGGAGGCTACGTACTCAAGGTGCCC
TTCATGGAGGGGCCCAAGCAGGCCGAGGGCATCGAGTACGCACAGGTCAACGTTCGCGTCCTGCTTCCCGAAGGT
GCCTCGAACGTCAAGGTCCAGACGGGGATCCCCGCGTCATCGCTGGTCGAGTCGTCGGTCGGCGTGCACAAGACA
TACCTGGACACGCTCGGGCGCACGGCGGTGGTGGTGCGCGCGCGCAATCTGGTGGACGAGTTCCGGGACCGCGAC
CTCGTCATCTACTACGAGACATCGGCCTTTGATCTGCTGCGGAAGCCGTTGATTGTCTTCTCGAGCGTGCTGACG
GCATTTGCGGCGGCCTGGGCCATCGGCATGGTCGAGGTGGGATTTTCGAGAAAGTGA
Gene >Hirsu2|10200
ATGAAGCCGCTCTCAGTCGCTTCGGCTCTCCTGGGCCTGCTGGCCTCGTCCGTCGCCGCGTCCAGCCCGCCGCAG
CCATCGTCGGCCAAGGTGACGCAGCCGGCCGAGTTCAAGCCGCCGCAGGTCTTCCGCAACGCCAACCTCGTGCAC
GTCATCTCGCTCGAGAAGAACTACGTCAAGGAACAGATCAACGTGCTCGTCGAAAATGTCTCCAAGAAGCCGCAG
GACGAATACTACCTCCCCTTCACCGCCGACCAGATGGCCCGGGTTGGCGGGTTCGAGGTCAAGGATCGCAAAGAC
GCCAATGCCGGGCCTTTCGAGGCCGACGTCGTCGAATTTGATCCGAACAGGTATGCATGGAATGCCCGGTCTACT
GTTTTCCGGCCGACCTCTGACCAAGAGTCCGTCGCCAGTGACGTGCAATACTATCGGATCCGGCTCCCTGCCCAG
CTCAAGCCCGGCAGTCAGCAGACGCTGGGAATCTCCTTCTACTACCTAAAGGCATATAGTCCCCTGCCGGCGTCG
ATCAAGCAGGACGAGACTCAGTTCCTCTCCTACGACTTCTCCGCCTATGCAACGTCCGCGTACCCGACCTCGAAG
CAAAAGACGGAGATCAAGGCGCCCAGCTCATCCATCCCCGACTACACCAATATGGCGGGCAAGGATGGCAAGGAG
CAGCATCCGCAGAAGCAGGGCGCAAAGCTCACGTACGGGCCCTTTGACAGCGAGGTGCCGGCCGGCGCCGCGTCC
CCGGCAAACGTGCGCGTCGAGTTTACCAAGCCCGTCACGCACGTCTCCAGCCTGGAGCGCGACATCGAGGTCAGC
CACTGGGGCGGCAACGTCGCGTTCGAGGAACGATACACGCTGTACAACCGAGGCGCCAACCTGTCGGTCCCGTTC
AACCGGGTCAAGTTTGCGCAGTCGCAGTACTTCAACCCTTCGTCCTTCGCGCTCAAGGAGATGCGCTTCCCGCTC
CAGGTCGGCAGCCTGGACCCCTACTTCACGGATACCATCGGCAACGTGTCGACGTCCAAGTTTAGGAGCAGCAAG
CGCGAGGCCCTGCTGGAGCTCAAGCCGCGATACCCCATCTTTGGTGGCTGGAAGTACCCCTTCACCATTGGCTGG
AACGCGAACGCGGCCGGGCTGCTGCGCAAGACGGCGGCGGGAGGCTACGTACTCAAGGTGCCCTTCATGGAGGGG
CCCAAGCAGGCCGAGGGCATCGAGTACGCACAGGTCAACGTTCGCGTCCTGCTTCCCGAAGGTGCCTCGTAAGTG
TCGACCATGGCTCGTGTCGTCGCAAGCTCAGCCGCTGACGGAGGGGGTTAAACAGGAACGTCAAGGTCCAGACGG
GGATCCCCGCGTCATCGCTGGTCGAGTCGTCGGTCGGCGTGCACAAGACATACCTGGACACGCTCGGGCGCACGG
CGGTGGTGGTGCGCGCGCGCAATCTGGTGGACGAGTTCCGGGACCGCGACCTCGTCATCTACTACGAGACATCGG
CCTTTGATCTGCTGCGGAAGCCGTTGATTGTCTTCTCGAGCGTGCTGACGGCATTTGCGGCGGCCTGGGCCATCG
GCATGGTCGAGGTGGGATTTTCGAGAAAGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail