Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10195
Gene name
LocationContig_80:30681..32337
Strand+
Gene length (bp)1656
Transcript length (bp)1602
Coding sequence length (bp)1602
Protein length (aa) 534

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01612 DNA_pol_A_exo1 3'-5' exonuclease 8.6E-14 157 343

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O93530|WRN_XENLA Werner syndrome ATP-dependent helicase homolog OS=Xenopus laevis GN=wrn PE=2 SV=1 167 343 9.0E-13
sp|Q9NVH0|EXD2_HUMAN Exonuclease 3'-5' domain-containing protein 2 OS=Homo sapiens GN=EXD2 PE=1 SV=2 162 341 4.0E-11
sp|O09053|WRN_MOUSE Werner syndrome ATP-dependent helicase homolog OS=Mus musculus GN=Wrn PE=1 SV=3 175 341 4.0E-10
sp|Q8N9H8|MUT7_HUMAN Exonuclease mut-7 homolog OS=Homo sapiens GN=EXD3 PE=2 SV=3 174 416 2.0E-09
sp|Q84LH3|WEX_ARATH Werner Syndrome-like exonuclease OS=Arabidopsis thaliana GN=WEX PE=1 SV=1 172 342 2.0E-07

GO

GO Term Description Terminal node
GO:0006139 nucleobase-containing compound metabolic process Yes
GO:0008408 3'-5' exonuclease activity Yes
GO:0003676 nucleic acid binding Yes
GO:0044237 cellular metabolic process No
GO:0004527 exonuclease activity No
GO:0003674 molecular_function No
GO:0046483 heterocycle metabolic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0005488 binding No
GO:0044238 primary metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0009987 cellular process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0004518 nuclease activity No
GO:1901360 organic cyclic compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:1901363 heterocyclic compound binding No
GO:0016788 hydrolase activity, acting on ester bonds No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10195
MASKKIVSLWNPSLGIRFSSSLKSACPQLDVGRSVHTTAGSGYGHHDRGDESTVSTESGLTIEAAALNEAPFIRN
GSYREPHDDSQVVETSDEKAHVPEDKAKDQQLVAPIFTMSSQLFDAAKAAPAGTAESFWSHTLYESTGDGGVKDK
VKVYYCTNAQTMESLCKTHFLGQKILGFDLEWSPFVVLGSTSPRTNLSLIQLASPSSIALFHVAVFAGDYADEGF
IAPTFRDIMGDPDVSKVGVNILGDCTRLRKHLGVETRGVFELSHLHNLIDKVSTGGYGRVGKSVVSLATQVEEHL
GLPLYKGEVVRRSNWLQRLTQKQIGYSAADAYAGIQLYYALEAKRKRLFPRPPRPDHAELGLPIRTALTNDEDGT
QKRSRAAKAPAAVEVPSGSEHTAPAPAELASAEPWVPPPPAHLPAADTRDARVVEADLMARQYRRAKSTPVAGGW
SRLVAYYLWHTNRDLDPEAIAKLMRSPPLQKHSVITYILAALVTEELPYDKARLRNEVMSFLHPTALTGKIRSLA
KDCEFIKS*
Coding >Hirsu2|10195
ATGGCGTCGAAGAAGATCGTCTCGCTGTGGAACCCAAGCCTGGGCATTCGGTTCTCTTCCAGTCTCAAGTCCGCG
TGTCCGCAATTAGATGTAGGCCGATCTGTTCACACGACCGCGGGGTCCGGCTATGGCCACCACGACCGCGGCGAC
GAGTCGACAGTGTCCACAGAGTCGGGCCTGACAATCGAGGCTGCTGCCCTCAACGAAGCCCCATTCATACGCAAT
GGCTCGTACCGTGAACCTCACGATGACTCACAAGTCGTCGAGACGAGCGATGAGAAGGCTCACGTCCCAGAGGAC
AAAGCCAAGGATCAGCAGCTGGTAGCACCCATCTTCACCATGTCCAGCCAGCTCTTCGACGCCGCCAAAGCCGCC
CCCGCCGGCACGGCCGAGTCCTTTTGGTCTCATACCTTGTACGAGAGCACCGGCGACGGCGGCGTCAAGGACAAG
GTCAAGGTGTACTACTGCACCAACGCGCAGACCATGGAATCGCTATGCAAGACGCACTTCCTCGGCCAGAAAATT
CTCGGCTTCGACCTCGAGTGGTCCCCGTTCGTAGTGCTCGGCTCGACCAGCCCGCGCACCAACCTCTCCCTGATC
CAGCTCGCGAGCCCGAGCAGCATCGCCCTCTTCCACGTGGCCGTGTTTGCCGGCGACTACGCCGATGAGGGCTTC
ATCGCGCCGACATTCCGGGACATCATGGGCGACCCCGACGTGAGCAAGGTCGGCGTCAACATCTTGGGCGATTGC
ACGCGCCTGAGGAAGCACCTCGGCGTCGAGACCCGGGGCGTGTTTGAGCTGAGCCATCTGCACAACCTGATCGAC
AAAGTGTCGACCGGAGGCTACGGCCGGGTCGGCAAGTCCGTCGTGTCTCTCGCCACCCAGGTCGAGGAGCACTTG
GGCCTGCCGCTGTACAAGGGGGAAGTGGTTCGCCGGAGCAACTGGCTACAGCGGCTCACGCAGAAGCAAATCGGC
TACTCCGCCGCCGATGCCTACGCAGGCATTCAGCTCTACTACGCCCTCGAGGCCAAACGCAAGAGGCTCTTCCCG
CGGCCGCCTCGGCCTGACCACGCAGAGCTCGGCCTGCCCATCCGCACCGCACTCACCAACGATGAGGATGGCACG
CAGAAGCGCAGCAGGGCAGCCAAGGCCCCAGCCGCCGTCGAGGTGCCCTCGGGATCGGAACACACTGCACCCGCA
CCAGCCGAGCTCGCGTCCGCAGAGCCCTGGGTGCCGCCGCCTCCCGCCCACCTGCCCGCCGCGGACACCAGGGAC
GCTCGCGTCGTCGAGGCCGACCTTATGGCCAGGCAGTACCGCCGCGCCAAGTCGACGCCCGTGGCGGGTGGATGG
TCTCGGCTTGTGGCCTACTACCTGTGGCACACCAACCGAGACCTCGATCCCGAGGCCATCGCCAAATTGATGCGC
AGCCCTCCCCTACAGAAACACTCCGTCATCACATACATCCTAGCGGCTCTCGTGACCGAGGAGCTGCCCTACGAC
AAGGCGCGGCTGAGGAATGAAGTCATGTCCTTTTTGCACCCGACGGCCCTGACTGGAAAGATTCGATCACTGGCC
AAGGACTGCGAATTCATCAAGTCATGA
Transcript >Hirsu2|10195
ATGGCGTCGAAGAAGATCGTCTCGCTGTGGAACCCAAGCCTGGGCATTCGGTTCTCTTCCAGTCTCAAGTCCGCG
TGTCCGCAATTAGATGTAGGCCGATCTGTTCACACGACCGCGGGGTCCGGCTATGGCCACCACGACCGCGGCGAC
GAGTCGACAGTGTCCACAGAGTCGGGCCTGACAATCGAGGCTGCTGCCCTCAACGAAGCCCCATTCATACGCAAT
GGCTCGTACCGTGAACCTCACGATGACTCACAAGTCGTCGAGACGAGCGATGAGAAGGCTCACGTCCCAGAGGAC
AAAGCCAAGGATCAGCAGCTGGTAGCACCCATCTTCACCATGTCCAGCCAGCTCTTCGACGCCGCCAAAGCCGCC
CCCGCCGGCACGGCCGAGTCCTTTTGGTCTCATACCTTGTACGAGAGCACCGGCGACGGCGGCGTCAAGGACAAG
GTCAAGGTGTACTACTGCACCAACGCGCAGACCATGGAATCGCTATGCAAGACGCACTTCCTCGGCCAGAAAATT
CTCGGCTTCGACCTCGAGTGGTCCCCGTTCGTAGTGCTCGGCTCGACCAGCCCGCGCACCAACCTCTCCCTGATC
CAGCTCGCGAGCCCGAGCAGCATCGCCCTCTTCCACGTGGCCGTGTTTGCCGGCGACTACGCCGATGAGGGCTTC
ATCGCGCCGACATTCCGGGACATCATGGGCGACCCCGACGTGAGCAAGGTCGGCGTCAACATCTTGGGCGATTGC
ACGCGCCTGAGGAAGCACCTCGGCGTCGAGACCCGGGGCGTGTTTGAGCTGAGCCATCTGCACAACCTGATCGAC
AAAGTGTCGACCGGAGGCTACGGCCGGGTCGGCAAGTCCGTCGTGTCTCTCGCCACCCAGGTCGAGGAGCACTTG
GGCCTGCCGCTGTACAAGGGGGAAGTGGTTCGCCGGAGCAACTGGCTACAGCGGCTCACGCAGAAGCAAATCGGC
TACTCCGCCGCCGATGCCTACGCAGGCATTCAGCTCTACTACGCCCTCGAGGCCAAACGCAAGAGGCTCTTCCCG
CGGCCGCCTCGGCCTGACCACGCAGAGCTCGGCCTGCCCATCCGCACCGCACTCACCAACGATGAGGATGGCACG
CAGAAGCGCAGCAGGGCAGCCAAGGCCCCAGCCGCCGTCGAGGTGCCCTCGGGATCGGAACACACTGCACCCGCA
CCAGCCGAGCTCGCGTCCGCAGAGCCCTGGGTGCCGCCGCCTCCCGCCCACCTGCCCGCCGCGGACACCAGGGAC
GCTCGCGTCGTCGAGGCCGACCTTATGGCCAGGCAGTACCGCCGCGCCAAGTCGACGCCCGTGGCGGGTGGATGG
TCTCGGCTTGTGGCCTACTACCTGTGGCACACCAACCGAGACCTCGATCCCGAGGCCATCGCCAAATTGATGCGC
AGCCCTCCCCTACAGAAACACTCCGTCATCACATACATCCTAGCGGCTCTCGTGACCGAGGAGCTGCCCTACGAC
AAGGCGCGGCTGAGGAATGAAGTCATGTCCTTTTTGCACCCGACGGCCCTGACTGGAAAGATTCGATCACTGGCC
AAGGACTGCGAATTCATCAAGTCATGA
Gene >Hirsu2|10195
ATGGCGTCGAAGAAGATCGTCTCGCTGTGGAACCCAAGCCTGGGCATTCGGTTCTCTTCCAGTCTCAAGTCCGCG
TGTCCGCAATTAGATGTAGGCCGATCTGTTCACACGACCGCGGGGTCCGGCTATGGCCACCACGACCGCGGCGAC
GAGTCGACAGTGTCCACAGAGTCGGGCCTGACAATCGAGGCTGCTGCCCTCAACGAAGCCCCATTCATACGCAAT
GGCTCGTACCGTGAACCTCACGATGACTCACAAGTCGTCGAGACGAGCGATGAGAAGGCTCACGTCCCAGAGGAC
AAAGCCAAGGATCAGCAGCTGGTAGCACCCATCTTCACCATGTCCAGCCAGCTCTTCGACGCCGCCAAAGCCGCC
CCCGCCGGCACGGCCGAGTCCTTTTGGTCTCATACCTTGTACGAGAGCACCGGCGACGGCGGCGTCAAGGACAAG
GTCAAGGTGTACTACTGCACCAACGCGCAGACCATGGAATCGCTATGCAAGACGCACTTCCTCGGCCAGAAAATT
CTCGGCTTCGACCTCGAGTGGTCCCCGTTCGTAGTGCTCGGCTCGACCAGCCCGCGCACCAACCTCTCCCTGATC
CAGCTCGCGAGCCCGAGCAGCATCGCCCTCTTCCACGTGGCCGTGTTTGCCGGCGACTACGCCGATGAGGGCTTC
ATCGCGCCGACATTCCGGGACATCATGGGCGACCCCGACGTGAGCAAGGTCGGCGTCAACATCTTGGGCGATTGC
ACGCGCCTGAGGAAGCACCTCGGCGTCGAGACCCGGGGCGTGTTTGAGCTGAGCCATCTGCACAACCTGATCGAC
AAAGTGTCGACCGGAGGCTACGGCCGGGTCGGCAAGTCCGTCGTGTCTCTCGCCACCCAGGTCGAGGAGCACTTG
GGCCTGCCGCTGTACAAGGGGGAAGTGGTTCGCCGGAGCAACTGGCTACAGCGGCTCACGCAGAAGCAAATCGGC
TGTGAGTAGCTTGTTCGCGCCGGTTCCGACGCGCCGCTGCTGACCTTTGCTCCAGACTCCGCCGCCGATGCCTAC
GCAGGCATTCAGCTCTACTACGCCCTCGAGGCCAAACGCAAGAGGCTCTTCCCGCGGCCGCCTCGGCCTGACCAC
GCAGAGCTCGGCCTGCCCATCCGCACCGCACTCACCAACGATGAGGATGGCACGCAGAAGCGCAGCAGGGCAGCC
AAGGCCCCAGCCGCCGTCGAGGTGCCCTCGGGATCGGAACACACTGCACCCGCACCAGCCGAGCTCGCGTCCGCA
GAGCCCTGGGTGCCGCCGCCTCCCGCCCACCTGCCCGCCGCGGACACCAGGGACGCTCGCGTCGTCGAGGCCGAC
CTTATGGCCAGGCAGTACCGCCGCGCCAAGTCGACGCCCGTGGCGGGTGGATGGTCTCGGCTTGTGGCCTACTAC
CTGTGGCACACCAACCGAGACCTCGATCCCGAGGCCATCGCCAAATTGATGCGCAGCCCTCCCCTACAGAAACAC
TCCGTCATCACATACATCCTAGCGGCTCTCGTGACCGAGGAGCTGCCCTACGACAAGGCGCGGCTGAGGAATGAA
GTCATGTCCTTTTTGCACCCGACGGCCCTGACTGGAAAGATTCGATCACTGGCCAAGGACTGCGAATTCATCAAG
TCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail