Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10191
Gene name
LocationContig_80:23032..25806
Strand-
Gene length (bp)2774
Transcript length (bp)2712
Coding sequence length (bp)2712
Protein length (aa) 904

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01434 Peptidase_M41 Peptidase family M41 5.6E-68 662 841
PF00004 AAA ATPase family associated with various cellular activities (AAA) 7.9E-41 445 578
PF17862 AAA_lid_3 AAA+ lid domain 4.1E-13 607 646
PF06480 FtsH_ext FtsH Extracellular 1.2E-10 238 342

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40341|YTA12_YEAST Mitochondrial respiratory chain complexes assembly protein YTA12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YTA12 PE=1 SV=2 263 858 0.0E+00
sp|P39925|AFG3_YEAST Mitochondrial respiratory chain complexes assembly protein AFG3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AFG3 PE=1 SV=1 260 874 0.0E+00
sp|Q9HGM3|YTA12_SCHPO Mitochondrial respiratory chain complexes assembly protein rca1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=yta12 PE=3 SV=1 247 848 0.0E+00
sp|Q8JZQ2|AFG32_MOUSE AFG3-like protein 2 OS=Mus musculus GN=Afg3l2 PE=1 SV=1 234 860 0.0E+00
sp|Q9Y4W6|AFG32_HUMAN AFG3-like protein 2 OS=Homo sapiens GN=AFG3L2 PE=1 SV=2 260 860 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40341|YTA12_YEAST Mitochondrial respiratory chain complexes assembly protein YTA12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YTA12 PE=1 SV=2 263 858 0.0E+00
sp|P39925|AFG3_YEAST Mitochondrial respiratory chain complexes assembly protein AFG3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AFG3 PE=1 SV=1 260 874 0.0E+00
sp|Q9HGM3|YTA12_SCHPO Mitochondrial respiratory chain complexes assembly protein rca1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=yta12 PE=3 SV=1 247 848 0.0E+00
sp|Q8JZQ2|AFG32_MOUSE AFG3-like protein 2 OS=Mus musculus GN=Afg3l2 PE=1 SV=1 234 860 0.0E+00
sp|Q9Y4W6|AFG32_HUMAN AFG3-like protein 2 OS=Homo sapiens GN=AFG3L2 PE=1 SV=2 260 860 0.0E+00
sp|Q2KJI7|AFG32_BOVIN AFG3-like protein 2 OS=Bos taurus GN=AFG3L2 PE=2 SV=1 255 860 0.0E+00
sp|Q0DHL4|FTSH8_ORYSJ ATP-dependent zinc metalloprotease FTSH 8, mitochondrial OS=Oryza sativa subsp. japonica GN=FTSH8 PE=3 SV=1 262 848 0.0E+00
sp|Q920A7|AFG31_MOUSE AFG3-like protein 1 OS=Mus musculus GN=Afg3l1 PE=1 SV=2 239 860 0.0E+00
sp|Q8VZI8|FTSHA_ARATH ATP-dependent zinc metalloprotease FTSH 10, mitochondrial OS=Arabidopsis thaliana GN=FTSH10 PE=1 SV=1 242 848 0.0E+00
sp|Q8S2A7|FTSH3_ORYSJ ATP-dependent zinc metalloprotease FTSH 3, mitochondrial OS=Oryza sativa subsp. japonica GN=FTSH3 PE=3 SV=1 262 848 0.0E+00
sp|Q84WU8|FTSH3_ARATH ATP-dependent zinc metalloprotease FTSH 3, mitochondrial OS=Arabidopsis thaliana GN=FTSH3 PE=1 SV=1 234 876 0.0E+00
sp|D0MGU8|FTSH_RHOM4 ATP-dependent zinc metalloprotease FtsH OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) GN=ftsH PE=3 SV=1 353 881 5.0E-180
sp|Q3ULF4|SPG7_MOUSE Paraplegin OS=Mus musculus GN=Spg7 PE=1 SV=1 234 847 5.0E-171
sp|Q9UQ90|SPG7_HUMAN Paraplegin OS=Homo sapiens GN=SPG7 PE=1 SV=2 234 847 1.0E-170
sp|A6LD25|FTSH_PARD8 ATP-dependent zinc metalloprotease FtsH OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=ftsH PE=3 SV=1 235 883 6.0E-170
sp|A0LN68|FTSH_SYNFM ATP-dependent zinc metalloprotease FtsH OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=ftsH PE=3 SV=1 213 834 4.0E-161
sp|P73437|FTSH4_SYNY3 ATP-dependent zinc metalloprotease FtsH 4 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ftsH4 PE=2 SV=1 230 845 2.0E-160
sp|P94304|FTSH_BACPE ATP-dependent zinc metalloprotease FtsH OS=Bacillus pseudofirmus (strain OF4) GN=ftsH PE=3 SV=2 382 884 3.0E-159
sp|B2UE66|FTSH_RALPJ ATP-dependent zinc metalloprotease FtsH OS=Ralstonia pickettii (strain 12J) GN=ftsH PE=3 SV=1 362 884 7.0E-159
sp|B8J992|FTSH_ANAD2 ATP-dependent zinc metalloprotease FtsH OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=ftsH PE=3 SV=1 340 846 2.0E-157
sp|Q6MJV1|FTSH2_BDEBA ATP-dependent zinc metalloprotease FtsH 2 OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=ftsH2 PE=3 SV=1 362 834 4.0E-155
sp|A0L4S0|FTSH_MAGMM ATP-dependent zinc metalloprotease FtsH OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=ftsH PE=3 SV=1 335 847 6.0E-155
sp|Q9WZ49|FTSH_THEMA ATP-dependent zinc metalloprotease FtsH OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=ftsH PE=1 SV=1 339 856 1.0E-154
sp|D5D8E3|FTSH_SULMD ATP-dependent zinc metalloprotease FtsH OS=Sulcia muelleri (strain DMIN) GN=ftsH PE=3 SV=1 274 843 2.0E-154
sp|D3F124|FTSH1_CONWI ATP-dependent zinc metalloprotease FtsH 1 OS=Conexibacter woesei (strain DSM 14684 / JCM 11494 / NBRC 100937 / ID131577) GN=ftsH1 PE=3 SV=1 362 892 2.0E-154
sp|P63343|FTSH_SALTY ATP-dependent zinc metalloprotease FtsH OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ftsH PE=3 SV=1 285 887 2.0E-154
sp|P63344|FTSH_SALTI ATP-dependent zinc metalloprotease FtsH OS=Salmonella typhi GN=ftsH PE=3 SV=1 285 887 2.0E-154
sp|B8H444|FTSH_CAUCN ATP-dependent zinc metalloprotease FtsH OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=ftsH PE=2 SV=1 344 847 6.0E-154
sp|Q67JH0|FTSH3_SYMTH ATP-dependent zinc metalloprotease FtsH 3 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=ftsH3 PE=3 SV=1 383 834 2.0E-153
sp|Q3B6R3|FTSH_CHLL7 ATP-dependent zinc metalloprotease FtsH OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=ftsH PE=3 SV=1 207 853 2.0E-153
sp|Q9ZEA2|FTSH_RICPR ATP-dependent zinc metalloprotease FtsH OS=Rickettsia prowazekii (strain Madrid E) GN=ftsH PE=3 SV=1 355 853 4.0E-153
sp|A0PXM8|FTSH_CLONN ATP-dependent zinc metalloprotease FtsH OS=Clostridium novyi (strain NT) GN=ftsH PE=3 SV=1 330 850 8.0E-153
sp|C1F8X6|FTSH_ACIC5 ATP-dependent zinc metalloprotease FtsH OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=ftsH PE=3 SV=1 350 839 1.0E-152
sp|P0AAI4|FTSH_SHIFL ATP-dependent zinc metalloprotease FtsH OS=Shigella flexneri GN=ftsH PE=3 SV=1 285 846 2.0E-152
sp|P0AAI3|FTSH_ECOLI ATP-dependent zinc metalloprotease FtsH OS=Escherichia coli (strain K12) GN=ftsH PE=1 SV=1 285 846 2.0E-152
sp|Q8X9L0|FTSH_ECO57 ATP-dependent zinc metalloprotease FtsH OS=Escherichia coli O157:H7 GN=ftsH PE=3 SV=1 285 846 2.0E-152
sp|C6V4R9|FTSH_NEORI ATP-dependent zinc metalloprotease FtsH OS=Neorickettsia risticii (strain Illinois) GN=ftsH PE=3 SV=1 336 848 4.0E-152
sp|P37476|FTSH_BACSU ATP-dependent zinc metalloprotease FtsH OS=Bacillus subtilis (strain 168) GN=ftsH PE=1 SV=1 382 853 6.0E-152
sp|Q92JJ9|FTSH_RICCN ATP-dependent zinc metalloprotease FtsH OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=ftsH PE=3 SV=1 355 884 6.0E-152
sp|Q4UN68|FTSH_RICFE ATP-dependent zinc metalloprotease FtsH OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=ftsH PE=3 SV=1 355 853 7.0E-152
sp|A8ZNZ4|FTSH_ACAM1 ATP-dependent zinc metalloprotease FtsH OS=Acaryochloris marina (strain MBIC 11017) GN=ftsH PE=3 SV=1 285 862 7.0E-152
sp|A9EXK6|FTSH4_SORC5 ATP-dependent zinc metalloprotease FtsH 4 OS=Sorangium cellulosum (strain So ce56) GN=ftsH4 PE=3 SV=1 362 846 1.0E-151
sp|Q68XR9|FTSH_RICTY ATP-dependent zinc metalloprotease FtsH OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=ftsH PE=3 SV=1 355 853 2.0E-151
sp|B3DY14|FTSH2_METI4 ATP-dependent zinc metalloprotease FtsH 2 OS=Methylacidiphilum infernorum (isolate V4) GN=ftsH2 PE=3 SV=1 354 869 3.0E-151
sp|Q89AF2|FTSH_BUCBP ATP-dependent zinc metalloprotease FtsH OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=ftsH PE=3 SV=1 285 834 4.0E-151
sp|A9BJK3|FTSH3_PETMO ATP-dependent zinc metalloprotease FtsH 3 OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=ftsH3 PE=3 SV=1 380 857 6.0E-151
sp|Q1RGP0|FTSH_RICBR ATP-dependent zinc metalloprotease FtsH OS=Rickettsia bellii (strain RML369-C) GN=ftsH PE=3 SV=1 336 861 7.0E-151
sp|B7J0N5|FTSH_BORBZ ATP-dependent zinc metalloprotease FtsH OS=Borrelia burgdorferi (strain ZS7) GN=ftsH PE=3 SV=1 238 853 9.0E-151
sp|Q4L3G8|FTSH_STAHJ ATP-dependent zinc metalloprotease FtsH OS=Staphylococcus haemolyticus (strain JCSC1435) GN=ftsH PE=3 SV=1 239 843 2.0E-150
sp|Q1AV13|FTSH_RUBXD ATP-dependent zinc metalloprotease FtsH OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=ftsH PE=3 SV=1 386 851 3.0E-150
sp|Q7TT47|SPG7_RAT Paraplegin OS=Rattus norvegicus GN=Spg7 PE=2 SV=1 234 847 3.0E-150
sp|Q6LUJ8|FTSH_PHOPR ATP-dependent zinc metalloprotease FtsH OS=Photobacterium profundum GN=ftsH PE=3 SV=1 334 890 3.0E-150
sp|A6TWP7|FTSH2_ALKMQ ATP-dependent zinc metalloprotease FtsH 2 OS=Alkaliphilus metalliredigens (strain QYMF) GN=ftsH2 PE=3 SV=1 311 860 4.0E-150
sp|P71377|FTSH_HAEIN ATP-dependent zinc metalloprotease FtsH OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=ftsH PE=3 SV=1 353 847 4.0E-150
sp|D5H7Z5|FTSH1_SALRM ATP-dependent zinc metalloprotease FtsH 1 OS=Salinibacter ruber (strain M8) GN=ftsH1 PE=3 SV=1 274 847 5.0E-150
sp|D1C1U7|FTSH1_SPHTD ATP-dependent zinc metalloprotease FtsH 1 OS=Sphaerobacter thermophilus (strain DSM 20745 / S 6022) GN=ftsH1 PE=3 SV=1 350 834 9.0E-150
sp|Q1LLA9|FTSH_CUPMC ATP-dependent zinc metalloprotease FtsH OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=ftsH PE=3 SV=1 360 896 1.0E-149
sp|P72991|FTSH3_SYNY3 ATP-dependent zinc metalloprotease FtsH 3 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ftsH3 PE=1 SV=1 360 845 2.0E-149
sp|B8D065|FTSH_HALOH ATP-dependent zinc metalloprotease FtsH OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=ftsH PE=3 SV=1 362 851 3.0E-149
sp|B8G4Q6|FTSH_CHLAD ATP-dependent zinc metalloprotease FtsH OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=ftsH PE=3 SV=1 368 890 7.0E-149
sp|Q8K9G8|FTSH_BUCAP ATP-dependent zinc metalloprotease FtsH OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=ftsH PE=3 SV=1 351 834 2.0E-148
sp|D0LWB8|FTSH_HALO1 ATP-dependent zinc metalloprotease FtsH OS=Haliangium ochraceum (strain DSM 14365 / JCM 11303 / SMP-2) GN=ftsH PE=3 SV=1 380 890 2.0E-148
sp|Q3JMH0|FTSH_BURP1 ATP-dependent zinc metalloprotease FtsH OS=Burkholderia pseudomallei (strain 1710b) GN=ftsH PE=3 SV=2 353 868 2.0E-148
sp|B1GZK7|FTSH_UNCTG ATP-dependent zinc metalloprotease FtsH OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=ftsH PE=3 SV=1 353 843 3.0E-148
sp|B2A3Q4|FTSH_NATTJ ATP-dependent zinc metalloprotease FtsH OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=ftsH PE=3 SV=1 354 855 1.0E-147
sp|B4SCV5|FTSH_PELPB ATP-dependent zinc metalloprotease FtsH OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=ftsH PE=3 SV=1 342 834 1.0E-147
sp|D1CDT8|FTSH_THET1 ATP-dependent zinc metalloprotease FtsH OS=Thermobaculum terrenum (strain ATCC BAA-798 / YNP1) GN=ftsH PE=3 SV=1 351 844 2.0E-147
sp|P59652|FTSH_STRR6 ATP-dependent zinc metalloprotease FtsH OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=ftsH PE=3 SV=1 262 834 3.0E-147
sp|O69076|FTSH_STRPN ATP-dependent zinc metalloprotease FtsH OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=ftsH PE=3 SV=3 262 834 4.0E-147
sp|A8F7F7|FTSH_PSELT ATP-dependent zinc metalloprotease FtsH OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=ftsH PE=3 SV=1 375 816 5.0E-147
sp|C5CES8|FTSH_KOSOT ATP-dependent zinc metalloprotease FtsH OS=Kosmotoga olearia (strain TBF 19.5.1) GN=ftsH PE=3 SV=1 309 844 6.0E-147
sp|B0K5A3|FTSH1_THEPX ATP-dependent zinc metalloprotease FtsH 1 OS=Thermoanaerobacter sp. (strain X514) GN=ftsH1 PE=3 SV=1 364 860 8.0E-147
sp|D1C8C0|FTSH4_SPHTD ATP-dependent zinc metalloprotease FtsH 4 OS=Sphaerobacter thermophilus (strain DSM 20745 / S 6022) GN=ftsh4 PE=3 SV=1 347 844 9.0E-147
sp|A1URA3|FTSH_BARBK ATP-dependent zinc metalloprotease FtsH OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=ftsH PE=3 SV=1 344 847 1.0E-146
sp|A9BFL9|FTSH1_PETMO ATP-dependent zinc metalloprotease FtsH 1 OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=ftsH1 PE=3 SV=1 356 862 2.0E-146
sp|Q1D491|FTSH_MYXXD ATP-dependent zinc metalloprotease FtsH OS=Myxococcus xanthus (strain DK 1622) GN=ftsH PE=3 SV=1 382 879 4.0E-145
sp|A9BHD3|FTSH2_PETMO ATP-dependent zinc metalloprotease FtsH 2 OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=ftsH2 PE=3 SV=1 342 832 8.0E-145
sp|A1AT11|FTSH_PELPD ATP-dependent zinc metalloprotease FtsH OS=Pelobacter propionicus (strain DSM 2379) GN=ftsH PE=3 SV=1 232 869 8.0E-145
sp|B9KXV3|FTSH1_THERP ATP-dependent zinc metalloprotease FtsH 1 OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=ftsH1 PE=3 SV=1 234 888 2.0E-144
sp|Q3A579|FTSH_PELCD ATP-dependent zinc metalloprotease FtsH OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=ftsH PE=3 SV=1 342 850 4.0E-144
sp|Q6MLS7|FTSH1_BDEBA ATP-dependent zinc metalloprotease FtsH 1 OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=ftsH1 PE=3 SV=1 333 834 4.0E-144
sp|P57462|FTSH_BUCAI ATP-dependent zinc metalloprotease FtsH OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=ftsH PE=3 SV=2 355 834 4.0E-144
sp|B4U7U4|FTSH_HYDS0 ATP-dependent zinc metalloprotease FtsH OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=ftsH PE=3 SV=1 353 843 4.0E-144
sp|A5W382|FTSH_PSEP1 ATP-dependent zinc metalloprotease FtsH OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=ftsH PE=3 SV=1 390 834 6.0E-144
sp|Q7UUZ7|FTSH1_RHOBA ATP-dependent zinc metalloprotease FtsH 1 OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=ftsH1 PE=3 SV=1 351 844 1.0E-143
sp|Q0TTK8|FTSH_CLOP1 ATP-dependent zinc metalloprotease FtsH OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=ftsH PE=3 SV=1 353 847 1.0E-143
sp|B9L3S8|FTSH2_THERP ATP-dependent zinc metalloprotease FtsH 2 OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=ftsH2 PE=3 SV=1 348 853 3.0E-143
sp|C7N1I1|FTSH_SLAHD ATP-dependent zinc metalloprotease FtsH OS=Slackia heliotrinireducens (strain ATCC 29202 / DSM 20476 / NCTC 11029 / RHS 1) GN=ftsH PE=3 SV=1 351 843 6.0E-143
sp|B2JVU2|FTSH_BURP8 ATP-dependent zinc metalloprotease FtsH OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=ftsH PE=3 SV=1 353 845 8.0E-143
sp|Q04Q03|FTSH_LEPBJ ATP-dependent zinc metalloprotease FtsH OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=ftsH PE=3 SV=1 380 843 1.0E-142
sp|Q2JNP0|FTSH_SYNJB ATP-dependent zinc metalloprotease FtsH OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=ftsH PE=3 SV=1 383 834 1.0E-142
sp|Q9ZM66|FTSH_HELPJ ATP-dependent zinc metalloprotease FtsH OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=ftsH PE=3 SV=1 362 834 1.0E-141
sp|O78516|FTSH_GUITH ATP-dependent zinc metalloprotease FtsH OS=Guillardia theta GN=ftsH PE=3 SV=1 235 844 1.0E-141
sp|D5HA94|FTSH2_SALRM ATP-dependent zinc metalloprotease FtsH 2 OS=Salinibacter ruber (strain M8) GN=ftsH2 PE=3 SV=1 261 843 3.0E-141
sp|P71408|FTSH_HELPY ATP-dependent zinc metalloprotease FtsH OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=ftsH PE=1 SV=2 362 851 3.0E-140
sp|Q7URM7|FTSH2_RHOBA ATP-dependent zinc metalloprotease FtsH 2 OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=ftsH2 PE=3 SV=1 362 843 4.0E-140
sp|D1BLD0|FTSH_VEIPT ATP-dependent zinc metalloprotease FtsH OS=Veillonella parvula (strain ATCC 10790 / DSM 2008 / JCM 12972 / Te3) GN=ftsH PE=3 SV=1 362 834 5.0E-140
sp|O83746|FTSH_TREPA ATP-dependent zinc metalloprotease FtsH OS=Treponema pallidum (strain Nichols) GN=ftsH PE=3 SV=1 321 839 7.0E-140
sp|P51327|FTSH_PORPU ATP-dependent zinc metalloprotease FtsH OS=Porphyra purpurea GN=ftsH PE=3 SV=1 273 834 1.0E-139
sp|O19922|FTSH_CYACA ATP-dependent zinc metalloprotease FtsH OS=Cyanidium caldarium GN=ftsH PE=3 SV=1 372 846 1.0E-139
sp|Q55700|FTSH2_SYNY3 ATP-dependent zinc metalloprotease FtsH 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ftsH2 PE=1 SV=1 353 834 2.0E-139
sp|O32617|FTSH_HELFC ATP-dependent zinc metalloprotease FtsH OS=Helicobacter felis (strain ATCC 49179 / NCTC 12436 / CS1) GN=ftsH PE=3 SV=1 362 834 3.0E-139
sp|P46469|FTSH_LACLA ATP-dependent zinc metalloprotease FtsH OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=ftsH PE=3 SV=1 362 847 6.0E-139
sp|Q2LUQ1|FTSH_SYNAS ATP-dependent zinc metalloprotease FtsH OS=Syntrophus aciditrophicus (strain SB) GN=ftsH PE=3 SV=1 351 847 6.0E-139
sp|A2SHH9|FTSH_METPP ATP-dependent zinc metalloprotease FtsH OS=Methylibium petroleiphilum (strain PM1) GN=ftsH PE=3 SV=1 361 842 2.0E-138
sp|O82150|FTSH_TOBAC ATP-dependent zinc metalloprotease FTSH, chloroplastic OS=Nicotiana tabacum GN=FTSH PE=2 SV=2 347 864 1.0E-137
sp|A1TZE0|FTSH_MARHV ATP-dependent zinc metalloprotease FtsH OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=ftsH PE=3 SV=1 356 843 2.0E-137
sp|B9MPK5|FTSH_CALBD ATP-dependent zinc metalloprotease FtsH OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=ftsH PE=3 SV=1 360 843 2.0E-137
sp|C8WEG0|FTSH_ZYMMN ATP-dependent zinc metalloprotease FtsH OS=Zymomonas mobilis subsp. mobilis (strain NCIMB 11163 / B70) GN=ftsH PE=3 SV=1 362 834 3.0E-137
sp|B3DV46|FTSH1_METI4 ATP-dependent zinc metalloprotease FtsH 1 OS=Methylacidiphilum infernorum (isolate V4) GN=ftsH1 PE=3 SV=1 356 843 3.0E-137
sp|P73179|FTSH1_SYNY3 ATP-dependent zinc metalloprotease FtsH 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ftsH1 PE=2 SV=1 351 834 4.0E-137
sp|Q39444|FTSH_CAPAN ATP-dependent zinc metalloprotease FTSH, chloroplastic (Fragment) OS=Capsicum annuum GN=FTSH PE=2 SV=1 342 831 6.0E-137
sp|Q39102|FTSH1_ARATH ATP-dependent zinc metalloprotease FTSH 1, chloroplastic OS=Arabidopsis thaliana GN=FTSH1 PE=1 SV=2 387 843 2.0E-136
sp|C7N914|FTSH_LEPBD ATP-dependent zinc metalloprotease FtsH OS=Leptotrichia buccalis (strain ATCC 14201 / DSM 1135 / JCM 12969 / NCTC 10249 / C-1013-b) GN=ftsH PE=3 SV=1 362 850 2.0E-136
sp|Q8YMZ8|FTSH_NOSS1 ATP-dependent zinc metalloprotease FtsH OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=ftsH PE=3 SV=1 369 814 2.0E-136
sp|Q88Z31|FTSH_LACPL ATP-dependent zinc metalloprotease FtsH OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=ftsH PE=2 SV=1 356 854 3.0E-136
sp|C6VKW6|FTSH_LACPJ ATP-dependent zinc metalloprotease FtsH OS=Lactobacillus plantarum (strain JDM1) GN=ftsH PE=3 SV=1 356 854 3.0E-136
sp|C8W731|FTSH_ATOPD ATP-dependent zinc metalloprotease FtsH OS=Atopobium parvulum (strain ATCC 33793 / DSM 20469 / JCM 10300 / VPI 0546) GN=ftsH PE=3 SV=1 307 851 4.0E-136
sp|Q83FV7|FTSH_TROWT ATP-dependent zinc metalloprotease FtsH OS=Tropheryma whipplei (strain Twist) GN=ftsH PE=3 SV=1 367 843 7.0E-136
sp|Q1XDF9|FTSH_PYRYE ATP-dependent zinc metalloprotease FtsH OS=Pyropia yezoensis GN=ftsH PE=3 SV=1 368 834 9.0E-136
sp|Q5Z974|FTSH1_ORYSJ ATP-dependent zinc metalloprotease FTSH 1, chloroplastic OS=Oryza sativa subsp. japonica GN=FTSH1 PE=2 SV=1 332 843 2.0E-135
sp|Q6MDI5|FTSH_PARUW ATP-dependent zinc metalloprotease FtsH OS=Protochlamydia amoebophila (strain UWE25) GN=ftsH PE=3 SV=1 375 849 7.0E-135
sp|P9WQN3|FTSH_MYCTU ATP-dependent zinc metalloprotease FtsH OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ftsH PE=1 SV=1 382 891 7.0E-135
sp|A5U8T5|FTSH_MYCTA ATP-dependent zinc metalloprotease FtsH OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=ftsH PE=3 SV=1 382 891 7.0E-135
sp|P0A4V9|FTSH_MYCBO ATP-dependent zinc metalloprotease FtsH OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ftsH PE=3 SV=1 382 891 7.0E-135
sp|P9WQN2|FTSH_MYCTO ATP-dependent zinc metalloprotease FtsH OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ftsH PE=3 SV=1 382 891 7.0E-135
sp|Q9FH02|FTSH5_ARATH ATP-dependent zinc metalloprotease FTSH 5, chloroplastic OS=Arabidopsis thaliana GN=FTSH5 PE=1 SV=1 342 843 8.0E-135
sp|Q9BAE0|FTSH_MEDSA ATP-dependent zinc metalloprotease FTSH, chloroplastic OS=Medicago sativa GN=FTSH PE=2 SV=1 351 864 1.0E-134
sp|C0ZPK5|FTSH_RHOE4 ATP-dependent zinc metalloprotease FtsH OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=ftsH PE=3 SV=1 351 894 3.0E-134
sp|B2UMY1|FTSH_AKKM8 ATP-dependent zinc metalloprotease FtsH OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=ftsH PE=3 SV=1 352 874 4.0E-134
sp|Q3JEE4|FTSH_NITOC ATP-dependent zinc metalloprotease FtsH OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=ftsH PE=3 SV=1 391 834 4.0E-134
sp|D2NQQ7|FTSH_ROTMD ATP-dependent zinc metalloprotease FtsH OS=Rothia mucilaginosa (strain DY-18) GN=ftsH PE=3 SV=1 238 889 4.0E-134
sp|B8I4B9|FTSH_CLOCE ATP-dependent zinc metalloprotease FtsH OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=ftsH PE=3 SV=1 364 832 7.0E-134
sp|Q9CD58|FTSH_MYCLE ATP-dependent zinc metalloprotease FtsH OS=Mycobacterium leprae (strain TN) GN=ftsH PE=3 SV=1 382 891 8.0E-134
sp|C7M0M0|FTSH_ACIFD ATP-dependent zinc metalloprotease FtsH OS=Acidimicrobium ferrooxidans (strain DSM 10331 / JCM 15462 / NBRC 103882 / ICP) GN=ftsH PE=3 SV=1 307 843 8.0E-134
sp|Q60AK1|FTSH_METCA ATP-dependent zinc metalloprotease FtsH OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=ftsH PE=3 SV=1 356 839 6.0E-133
sp|O80860|FTSH2_ARATH ATP-dependent zinc metalloprotease FTSH 2, chloroplastic OS=Arabidopsis thaliana GN=FTSH2 PE=1 SV=1 350 843 2.0E-132
sp|Q67T82|FTSH2_SYMTH ATP-dependent zinc metalloprotease FtsH 2 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=ftsH2 PE=3 SV=1 357 843 2.0E-132
sp|Q6KHA4|FTSH_MYCMO ATP-dependent zinc metalloprotease FtsH OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=ftsH PE=3 SV=1 356 839 2.0E-131
sp|Q1PDW5|FTSH6_ARATH ATP-dependent zinc metalloprotease FTSH 6, chloroplastic OS=Arabidopsis thaliana GN=FTSH6 PE=2 SV=1 387 853 3.0E-131
sp|Q655S1|FTSH2_ORYSJ ATP-dependent zinc metalloprotease FTSH 2, chloroplastic OS=Oryza sativa subsp. japonica GN=FTSH2 PE=3 SV=1 389 843 4.0E-131
sp|Q10ZF7|FTSH_TRIEI ATP-dependent zinc metalloprotease FtsH OS=Trichodesmium erythraeum (strain IMS101) GN=ftsH PE=3 SV=1 384 843 2.0E-130
sp|Q5SI82|FTSH_THET8 ATP-dependent zinc metalloprotease FtsH OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=ftsH PE=1 SV=1 367 848 7.0E-130
sp|B7T1V0|FTSH_VAULI ATP-dependent zinc metalloprotease FtsH OS=Vaucheria litorea GN=ftsH PE=3 SV=1 374 839 9.0E-130
sp|O67077|FTSH_AQUAE ATP-dependent zinc metalloprotease FtsH OS=Aquifex aeolicus (strain VF5) GN=ftsH PE=1 SV=1 350 843 1.0E-129
sp|P49825|FTSH_ODOSI ATP-dependent zinc metalloprotease FtsH OS=Odontella sinensis GN=ftsH PE=3 SV=1 353 843 7.0E-129
sp|D4HA34|FTSH_PROAS ATP-dependent zinc metalloprotease FtsH OS=Propionibacterium acnes (strain SK137) GN=ftsH PE=3 SV=1 349 843 9.0E-129
sp|Q2SF13|FTSH_HAHCH ATP-dependent zinc metalloprotease FtsH OS=Hahella chejuensis (strain KCTC 2396) GN=ftsH PE=3 SV=1 230 834 1.0E-128
sp|A9FDV9|FTSH2_SORC5 ATP-dependent zinc metalloprotease FtsH 2 OS=Sorangium cellulosum (strain So ce56) GN=ftsH2 PE=3 SV=1 287 839 2.0E-128
sp|Q9TJ83|FTSH_CYAME ATP-dependent zinc metalloprotease FtsH OS=Cyanidioschyzon merolae GN=ftsH PE=3 SV=1 364 834 3.0E-128
sp|Q8W585|FTSH8_ARATH ATP-dependent zinc metalloprotease FTSH 8, chloroplastic OS=Arabidopsis thaliana GN=FTSH8 PE=1 SV=1 350 843 3.0E-128
sp|C7MC16|FTSH_BRAFD ATP-dependent zinc metalloprotease FtsH OS=Brachybacterium faecium (strain ATCC 43885 / DSM 4810 / NCIB 9860) GN=ftsH PE=3 SV=1 227 843 1.0E-127
sp|B0B970|FTSH_CHLT2 ATP-dependent zinc metalloprotease FtsH OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=ftsH PE=3 SV=1 354 873 4.0E-127
sp|D3FFN2|FTSH_MYCGH ATP-dependent zinc metalloprotease FtsH OS=Mycoplasma gallisepticum (strain R(high / passage 156)) GN=ftsH PE=3 SV=1 383 839 4.0E-127
sp|D2QZ34|FTSH_PIRSD ATP-dependent zinc metalloprotease FtsH OS=Pirellula staleyi (strain ATCC 27377 / DSM 6068 / ICPB 4128) GN=ftsH PE=3 SV=1 364 843 5.0E-127
sp|D3EZK2|FTSH3_CONWI ATP-dependent zinc metalloprotease FtsH 3 OS=Conexibacter woesei (strain DSM 14684 / JCM 11494 / NBRC 100937 / ID131577) GN=ftsH3 PE=3 SV=1 349 834 6.0E-127
sp|A9NE17|FTSH_ACHLI ATP-dependent zinc metalloprotease FtsH OS=Acholeplasma laidlawii (strain PG-8A) GN=ftsH PE=3 SV=1 357 856 6.0E-126
sp|A6QBN8|FTSH_SULNB ATP-dependent zinc metalloprotease FtsH OS=Sulfurovum sp. (strain NBC37-1) GN=ftsH PE=3 SV=1 287 834 8.0E-126
sp|Q8EUA6|FTSH_MYCPE ATP-dependent zinc metalloprotease FtsH OS=Mycoplasma penetrans (strain HF-2) GN=ftsH PE=3 SV=1 339 836 5.0E-125
sp|P75120|FTSH_MYCPN ATP-dependent zinc metalloprotease FtsH OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=ftsH PE=3 SV=1 355 833 8.0E-124
sp|Q6M2F0|FTSH_CORGL ATP-dependent zinc metalloprotease FtsH OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=ftsH PE=3 SV=1 362 850 1.0E-123
sp|Q83XX3|FTSH_OENOE ATP-dependent zinc metalloprotease FtsH OS=Oenococcus oeni GN=ftsH PE=2 SV=1 348 834 1.0E-123
sp|P54813|YME1_CAEEL ATP-dependent zinc metalloprotease YME1 homolog OS=Caenorhabditis elegans GN=ymel-1 PE=3 SV=2 356 847 3.0E-123
sp|D1C4U5|FTSH3_SPHTD ATP-dependent zinc metalloprotease FtsH 3 OS=Sphaerobacter thermophilus (strain DSM 20745 / S 6022) GN=ftsH3 PE=3 SV=1 350 847 4.0E-123
sp|Q6F0E5|FTSH_MESFL ATP-dependent zinc metalloprotease FtsH OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=ftsH PE=3 SV=1 356 828 4.0E-122
sp|B3R057|FTSH1_PHYMT ATP-dependent zinc metalloprotease FtsH 1 OS=Phytoplasma mali (strain AT) GN=ftsH1 PE=3 SV=1 353 843 4.0E-122
sp|Q8LQJ8|FTSH5_ORYSJ ATP-dependent zinc metalloprotease FTSH 5, mitochondrial OS=Oryza sativa subsp. japonica GN=FTSH5 PE=3 SV=1 406 845 3.0E-121
sp|P47695|FTSH_MYCGE ATP-dependent zinc metalloprotease FtsH OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=ftsH PE=3 SV=1 362 833 3.0E-121
sp|O80983|FTSH4_ARATH ATP-dependent zinc metalloprotease FTSH 4, mitochondrial OS=Arabidopsis thaliana GN=FTSH4 PE=1 SV=2 406 834 4.0E-121
sp|Q67WJ2|FTSH6_ORYSJ ATP-dependent zinc metalloprotease FTSH 6, chloroplastic OS=Oryza sativa subsp. japonica GN=FTSH6 PE=3 SV=1 348 843 5.0E-121
sp|A9GRC9|FTSH1_SORC5 ATP-dependent zinc metalloprotease FtsH 1 OS=Sorangium cellulosum (strain So ce56) GN=ftsH1 PE=3 SV=1 382 834 6.0E-121
sp|A0LR74|FTSH_ACIC1 ATP-dependent zinc metalloprotease FtsH OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=ftsH PE=3 SV=1 242 845 7.0E-121
sp|D1J722|FTSH_ECTSI ATP-dependent zinc metalloprotease FtsH OS=Ectocarpus siliculosus GN=ftsH PE=3 SV=1 388 813 1.0E-120
sp|Q8LQJ9|FTSH4_ORYSJ ATP-dependent zinc metalloprotease FTSH 4, mitochondrial OS=Oryza sativa subsp. japonica GN=FTSH4 PE=3 SV=1 404 845 3.0E-120
sp|D1AXT4|FTSH_STRM9 ATP-dependent zinc metalloprotease FtsH OS=Streptobacillus moniliformis (strain ATCC 14647 / DSM 12112 / NCTC 10651 / 9901) GN=ftsH PE=3 SV=1 374 858 2.0E-119
sp|A9GAW6|FTSH3_SORC5 ATP-dependent zinc metalloprotease FtsH 3 OS=Sorangium cellulosum (strain So ce56) GN=ftsH3 PE=3 SV=1 383 839 3.0E-119
sp|Q9FGM0|FTSHB_ARATH ATP-dependent zinc metalloprotease FTSH 11, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=FTSH11 PE=1 SV=1 395 843 4.0E-119
sp|B3PNH3|FTSH_MYCA5 ATP-dependent zinc metalloprotease FtsH OS=Mycoplasma arthritidis (strain 158L3-1) GN=ftsH PE=3 SV=1 221 839 3.0E-117
sp|Q03Z46|FTSH_LEUMM ATP-dependent zinc metalloprotease FtsH OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=ftsH PE=3 SV=1 386 834 4.0E-117
sp|B3R0R7|FTSH3_PHYMT ATP-dependent zinc metalloprotease FtsH 3 OS=Phytoplasma mali (strain AT) GN=ftsH3 PE=3 SV=1 327 843 7.0E-117
sp|B3QZS3|FTSH2_PHYMT ATP-dependent zinc metalloprotease FtsH 2 OS=Phytoplasma mali (strain AT) GN=ftsH2 PE=3 SV=1 407 844 1.0E-116
sp|Q67LC0|FTSH1_SYMTH ATP-dependent zinc metalloprotease FtsH 1 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=ftsH1 PE=3 SV=1 357 778 5.0E-115
sp|B0K657|FTSH2_THEPX ATP-dependent zinc metalloprotease FtsH 2 OS=Thermoanaerobacter sp. (strain X514) GN=ftsH2 PE=3 SV=1 405 836 6.0E-115
sp|Q4A5F0|FTSH_MYCS5 ATP-dependent zinc metalloprotease FtsH OS=Mycoplasma synoviae (strain 53) GN=ftsH PE=3 SV=2 356 839 1.0E-114
sp|Q9SD67|FTSH7_ARATH ATP-dependent zinc metalloprotease FTSH 7, chloroplastic OS=Arabidopsis thaliana GN=FTSH7 PE=2 SV=1 405 774 4.0E-114
sp|A2ZVG7|FTSH9_ORYSJ ATP-dependent zinc metalloprotease FTSH 9, chloroplastic/mitochondrial OS=Oryza sativa subsp. japonica GN=FTSH9 PE=3 SV=1 407 843 5.0E-114
sp|Q98PE4|FTSH_MYCPU ATP-dependent zinc metalloprotease FtsH OS=Mycoplasma pulmonis (strain UAB CTIP) GN=ftsH PE=3 SV=1 355 839 4.0E-113
sp|B1AI94|FTSH_UREP2 ATP-dependent zinc metalloprotease FtsH OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=ftsH PE=3 SV=1 405 836 9.0E-113
sp|P46508|YME1_SCHMA ATP-dependent zinc metalloprotease YME1 homolog OS=Schistosoma mansoni PE=2 SV=1 405 844 8.0E-112
sp|P32795|YME1_YEAST Mitochondrial inner membrane i-AAA protease supercomplex subunit YME1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YME1 PE=1 SV=1 405 834 2.0E-111
sp|Q2NIN5|FTSH_AYWBP ATP-dependent zinc metalloprotease FtsH OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=ftsH PE=3 SV=1 404 844 2.0E-111
sp|Q9FIM2|FTSH9_ARATH ATP-dependent zinc metalloprotease FTSH 9, chloroplastic OS=Arabidopsis thaliana GN=FTSH9 PE=2 SV=1 405 774 8.0E-110
sp|B2XTF7|FTSH_HETA2 ATP-dependent zinc metalloprotease FtsH OS=Heterosigma akashiwo (strain NIES-293) GN=ftsH PE=3 SV=1 395 834 1.0E-109
sp|O88967|YMEL1_MOUSE ATP-dependent zinc metalloprotease YME1L1 OS=Mus musculus GN=Yme1l1 PE=1 SV=1 405 846 5.0E-109
sp|Q6H6R9|FTSH7_ORYSJ ATP-dependent zinc metalloprotease FTSH 7, chloroplastic OS=Oryza sativa subsp. japonica GN=FTSH7 PE=3 SV=1 399 781 2.0E-108
sp|Q925S8|YMEL1_RAT ATP-dependent zinc metalloprotease YME1L1 OS=Rattus norvegicus GN=Yme1l1 PE=2 SV=1 405 846 5.0E-108
sp|Q96TA2|YMEL1_HUMAN ATP-dependent zinc metalloprotease YME1L1 OS=Homo sapiens GN=YME1L1 PE=1 SV=2 405 846 6.0E-108
sp|C5J6A7|FTSH_MYCCR ATP-dependent zinc metalloprotease FtsH OS=Mycoplasma conjunctivae (strain ATCC 25834 / HRC/581 / NCTC 10147) GN=ftsH PE=3 SV=1 350 842 2.0E-107
sp|D1C2C6|FTSH2_SPHTD ATP-dependent zinc metalloprotease FtsH 2 OS=Sphaerobacter thermophilus (strain DSM 20745 / S 6022) GN=ftsH2 PE=3 SV=1 278 834 1.0E-106
sp|O59824|YME1_SCHPO ATP-dependent zinc metalloprotease YME1 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC965.04c PE=3 SV=1 400 843 3.0E-105
sp|A6TSZ1|FTSH1_ALKMQ ATP-dependent zinc metalloprotease FtsH 1 OS=Alkaliphilus metalliredigens (strain QYMF) GN=ftsH1 PE=3 SV=1 366 839 1.0E-104
sp|D3FA80|FTSH2_CONWI ATP-dependent zinc metalloprotease FtsH 2 OS=Conexibacter woesei (strain DSM 14684 / JCM 11494 / NBRC 100937 / ID131577) GN=ftsH2 PE=3 SV=1 382 834 8.0E-104
sp|B1ZMG6|FTSH_OPITP ATP-dependent zinc metalloprotease FtsH OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=ftsH PE=3 SV=1 343 847 2.0E-100
sp|A9KIG5|FTSH_CLOPH ATP-dependent zinc metalloprotease FtsH OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=ftsH PE=3 SV=1 380 845 6.0E-100
sp|P45219|FTSHL_HAEIN ATP-dependent zinc metalloprotease FtsH homolog OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1465 PE=3 SV=1 524 848 4.0E-81
sp|O22993|FTSI1_ARATH Probable inactive ATP-dependent zinc metalloprotease FTSHI 1, chloroplastic OS=Arabidopsis thaliana GN=FTSHI1 PE=1 SV=1 389 788 9.0E-80
sp|Q9M895|FTSI3_ARATH Probable inactive ATP-dependent zinc metalloprotease FTSHI 3, chloroplastic OS=Arabidopsis thaliana GN=FTSHI3 PE=1 SV=1 405 659 4.0E-79
sp|A8MPR5|FTSI2_ARATH Probable inactive ATP-dependent zinc metalloprotease FTSHI 2, chloroplastic OS=Arabidopsis thaliana GN=FTSHI2 PE=1 SV=1 400 843 7.0E-77
sp|P85190|FTSH_HELAN ATP-dependent zinc metalloprotease FTSH, chloroplastic (Fragment) OS=Helianthus annuus GN=FTSH PE=1 SV=1 461 712 9.0E-71
sp|F4KF14|FTSI4_ARATH Probable inactive ATP-dependent zinc metalloprotease FTSHI 4, chloroplastic OS=Arabidopsis thaliana GN=FTSHI4 PE=1 SV=1 388 847 2.0E-68
sp|Q8TX03|PAN_METKA Proteasome-activating nucleotidase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=pan PE=3 SV=1 392 660 1.0E-64
sp|Q975U2|PAN_SULTO Proteasome-activating nucleotidase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=pan PE=3 SV=2 394 650 5.0E-64
sp|C3NFW6|PAN_SULIN Proteasome-activating nucleotidase OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=pan PE=3 SV=1 405 652 5.0E-63
sp|C3N7K8|PAN_SULIY Proteasome-activating nucleotidase OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=pan PE=3 SV=1 405 652 8.0E-63
sp|C3MY47|PAN_SULIM Proteasome-activating nucleotidase OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=pan PE=3 SV=1 405 652 8.0E-63
sp|C3MRF1|PAN_SULIL Proteasome-activating nucleotidase OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=pan PE=3 SV=1 405 652 8.0E-63
sp|C4KIR6|PAN_SULIK Proteasome-activating nucleotidase OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=pan PE=3 SV=1 405 652 8.0E-63
sp|C3MZI6|PAN_SULIA Proteasome-activating nucleotidase OS=Sulfolobus islandicus (strain M.16.27) GN=pan PE=3 SV=1 405 652 8.0E-63
sp|Q980M1|PAN_SULSO Proteasome-activating nucleotidase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=pan PE=3 SV=1 405 652 2.0E-62
sp|Q58576|PAN_METJA Proteasome-activating nucleotidase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=pan PE=1 SV=1 393 653 4.0E-59
sp|D4GUJ7|PAN1_HALVD Proteasome-activating nucleotidase 1 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=pan1 PE=1 SV=2 393 652 9.0E-59
sp|A6VHR1|PAN_METM7 Proteasome-activating nucleotidase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=pan PE=3 SV=1 393 660 2.0E-58
sp|Q8PY58|PAN_METMA Proteasome-activating nucleotidase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=pan PE=3 SV=1 402 652 3.0E-58
sp|O28303|PAN_ARCFU Proteasome-activating nucleotidase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=pan PE=1 SV=1 397 653 4.0E-58
sp|B8GGN4|PAN_METPE Proteasome-activating nucleotidase OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=pan PE=3 SV=1 406 662 5.0E-58
sp|C5A6P8|PAN_THEGJ Proteasome-activating nucleotidase OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=pan PE=3 SV=1 404 678 7.0E-58
sp|O26824|PAN_METTH Proteasome-activating nucleotidase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=pan PE=3 SV=1 405 654 2.0E-57
sp|Q9YAC7|PAN_AERPE Proteasome-activating nucleotidase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=pan PE=3 SV=1 394 659 2.0E-57
sp|Q5JHS5|PAN_THEKO Proteasome-activating nucleotidase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=pan PE=3 SV=1 404 678 2.0E-57
sp|A9A916|PAN_METM6 Proteasome-activating nucleotidase OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=pan PE=3 SV=1 393 660 2.0E-57
sp|Q9HRW6|PAN1_HALSA Proteasome-activating nucleotidase 1 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=pan1 PE=3 SV=3 393 652 3.0E-57
sp|Q6LWR0|PAN_METMP Proteasome-activating nucleotidase OS=Methanococcus maripaludis (strain S2 / LL) GN=pan PE=3 SV=1 393 660 3.0E-57
sp|Q0W257|PAN_METAR Proteasome-activating nucleotidase OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=pan PE=3 SV=1 404 654 3.0E-57
sp|B6YXR2|PAN_THEON Proteasome-activating nucleotidase OS=Thermococcus onnurineus (strain NA1) GN=pan PE=3 SV=1 405 678 6.0E-57
sp|A4G0S4|PAN_METM5 Proteasome-activating nucleotidase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=pan PE=3 SV=1 393 660 9.0E-57
sp|Q8TI88|PAN_METAC Proteasome-activating nucleotidase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=pan PE=3 SV=2 402 652 3.0E-56
sp|Q9V287|PAN_PYRAB Proteasome-activating nucleotidase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=pan PE=3 SV=2 405 661 3.0E-56
sp|A6UQT3|PAN_METVS Proteasome-activating nucleotidase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=pan PE=3 SV=1 393 658 5.0E-56
sp|A7I8B8|PAN_METB6 Proteasome-activating nucleotidase OS=Methanoregula boonei (strain 6A8) GN=pan PE=3 SV=1 407 652 1.0E-55
sp|O57940|PAN_PYRHO Proteasome-activating nucleotidase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=pan PE=3 SV=1 405 661 2.0E-55
sp|Q9SEI2|PS6AA_ARATH 26S protease regulatory subunit 6A homolog A OS=Arabidopsis thaliana GN=RPT5A PE=1 SV=1 392 652 6.0E-55
sp|O23894|PRS6A_BRACM 26S protease regulatory subunit 6A homolog OS=Brassica campestris GN=TBP1 PE=2 SV=1 392 652 6.0E-55
sp|Q9FXT9|PRS7_ORYSJ 26S protease regulatory subunit 7 OS=Oryza sativa subsp. japonica GN=RPT1A PE=2 SV=1 397 660 7.0E-55
sp|Q8U4H3|PAN_PYRFU Proteasome-activating nucleotidase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=pan PE=1 SV=1 405 654 7.0E-55
sp|Q41365|PRS7_SPIOL 26S protease regulatory subunit 7 OS=Spinacia oleracea GN=RPT1 PE=2 SV=1 397 660 9.0E-55
sp|A3CV35|PAN_METMJ Proteasome-activating nucleotidase OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=pan PE=3 SV=1 407 658 2.0E-54
sp|O64982|PRS7_PRUPE 26S protease regulatory subunit 7 OS=Prunus persica GN=RPT1 PE=2 SV=1 397 660 4.0E-54
sp|Q9HNP9|PAN2_HALSA Proteasome-activating nucleotidase 2 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=pan2 PE=3 SV=1 392 654 5.0E-54
sp|Q9SSB5|PRS7A_ARATH 26S protease regulatory subunit 7 homolog A OS=Arabidopsis thaliana GN=RPT1A PE=1 SV=1 397 660 5.0E-54
sp|O04019|PS6AB_ARATH 26S protease regulatory subunit 6A homolog B OS=Arabidopsis thaliana GN=RPT5B PE=1 SV=3 392 652 1.0E-53
sp|P54776|PRS6A_SOLLC 26S protease regulatory subunit 6A homolog OS=Solanum lycopersicum GN=TBP1 PE=2 SV=1 392 652 2.0E-53
sp|P46465|PRS6A_ORYSJ 26S protease regulatory subunit 6A homolog OS=Oryza sativa subsp. japonica GN=TBP1 PE=2 SV=2 392 652 4.0E-53
sp|Q86JA1|PRS7_DICDI 26S protease regulatory subunit 7 OS=Dictyostelium discoideum GN=psmC2 PE=1 SV=1 405 653 6.0E-53
sp|Q9SSB4|PRS7B_ARATH 26S protease regulatory subunit 7 homolog B OS=Arabidopsis thaliana GN=RPT1B PE=1 SV=2 407 660 8.0E-53
sp|P40327|PRS4_YEAST 26S protease regulatory subunit 4 homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPT2 PE=1 SV=3 407 653 1.0E-52
sp|Q2FQ56|PAN_METHJ Proteasome-activating nucleotidase OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=pan PE=3 SV=1 325 658 1.0E-52
sp|P62198|PRS8_RAT 26S protease regulatory subunit 8 OS=Rattus norvegicus GN=Psmc5 PE=1 SV=1 410 664 1.0E-52
sp|P62197|PRS8_PIG 26S protease regulatory subunit 8 OS=Sus scrofa GN=PSMC5 PE=2 SV=1 410 664 1.0E-52
sp|P62196|PRS8_MOUSE 26S protease regulatory subunit 8 OS=Mus musculus GN=Psmc5 PE=1 SV=1 410 664 1.0E-52
sp|P62195|PRS8_HUMAN 26S protease regulatory subunit 8 OS=Homo sapiens GN=PSMC5 PE=1 SV=1 410 664 1.0E-52
sp|P62194|PRS8_BOVIN 26S protease regulatory subunit 8 OS=Bos taurus GN=PSMC5 PE=2 SV=1 410 664 1.0E-52
sp|P62193|PRS4_RAT 26S protease regulatory subunit 4 OS=Rattus norvegicus GN=Psmc1 PE=2 SV=1 397 653 1.0E-52
sp|P62192|PRS4_MOUSE 26S protease regulatory subunit 4 OS=Mus musculus GN=Psmc1 PE=1 SV=1 397 653 1.0E-52
sp|P62191|PRS4_HUMAN 26S protease regulatory subunit 4 OS=Homo sapiens GN=PSMC1 PE=1 SV=1 397 653 1.0E-52
sp|Q8SR13|PRS6A_ENCCU 26S protease regulatory subunit 6A OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPT5 PE=1 SV=1 407 654 3.0E-52
sp|O18413|PRS8_DROME 26S protease regulatory subunit 8 OS=Drosophila melanogaster GN=Rpt6 PE=1 SV=2 407 664 3.0E-52
sp|P48601|PRS4_DROME 26S protease regulatory subunit 4 OS=Drosophila melanogaster GN=Rpt2 PE=1 SV=2 400 653 3.0E-52
sp|P54814|PRS8_MANSE 26S protease regulatory subunit 8 OS=Manduca sexta PE=2 SV=1 410 664 3.0E-52
sp|Q9C5U3|PRS8A_ARATH 26S protease regulatory subunit 8 homolog A OS=Arabidopsis thaliana GN=RPT6A PE=1 SV=1 410 664 4.0E-52
sp|Q94BQ2|PRS8B_ARATH 26S protease regulatory subunit 8 homolog B OS=Arabidopsis thaliana GN=RPT6B PE=1 SV=1 410 664 4.0E-52
sp|P33297|PRS6A_YEAST 26S protease regulatory subunit 6A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPT5 PE=1 SV=3 392 652 5.0E-52
sp|Q63347|PRS7_RAT 26S protease regulatory subunit 7 OS=Rattus norvegicus GN=Psmc2 PE=1 SV=3 405 653 5.0E-52
sp|Q4R4R0|PRS7_MACFA 26S protease regulatory subunit 7 OS=Macaca fascicularis GN=PSMC2 PE=2 SV=3 405 653 6.0E-52
sp|P35998|PRS7_HUMAN 26S protease regulatory subunit 7 OS=Homo sapiens GN=PSMC2 PE=1 SV=3 405 653 6.0E-52
sp|Q5E9F9|PRS7_BOVIN 26S protease regulatory subunit 7 OS=Bos taurus GN=PSMC2 PE=2 SV=3 405 653 6.0E-52
sp|P46471|PRS7_MOUSE 26S protease regulatory subunit 7 OS=Mus musculus GN=Psmc2 PE=1 SV=5 405 653 6.0E-52
sp|P46472|PRS7_XENLA 26S protease regulatory subunit 7 OS=Xenopus laevis GN=psmc2 PE=2 SV=1 405 653 7.0E-52
sp|O28972|Y1297_ARCFU Cell division cycle protein 48 homolog AF_1297 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_1297 PE=3 SV=1 405 652 7.0E-52
sp|Q2KIW6|PRS10_BOVIN 26S protease regulatory subunit 10B OS=Bos taurus GN=PSMC6 PE=2 SV=1 405 652 1.0E-51
sp|P62334|PRS10_MOUSE 26S protease regulatory subunit 10B OS=Mus musculus GN=Psmc6 PE=1 SV=1 405 652 1.0E-51
sp|P62335|PRS10_ICTTR 26S protease regulatory subunit 10B OS=Ictidomys tridecemlineatus GN=PSMC6 PE=2 SV=1 405 652 1.0E-51
sp|P62333|PRS10_HUMAN 26S protease regulatory subunit 10B OS=Homo sapiens GN=PSMC6 PE=1 SV=1 405 652 1.0E-51
sp|Q9HPF0|CDCH_HALSA Protein CdcH OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=cdcH PE=3 SV=1 404 652 1.0E-51
sp|O42931|PRS7_SCHPO 26S protease regulatory subunit 7 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpt1 PE=1 SV=2 405 660 2.0E-51
sp|Q5R8D7|PRS7_PONAB 26S protease regulatory subunit 7 OS=Pongo abelii GN=PSMC2 PE=2 SV=3 405 653 3.0E-51
sp|Q90732|PRS4_CHICK 26S protease regulatory subunit 4 OS=Gallus gallus GN=PSMC1 PE=2 SV=1 400 653 3.0E-51
sp|Q5UT56|PAN2_HALVD Proteasome-activating nucleotidase 2 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=pan2 PE=2 SV=1 392 652 4.0E-51
sp|O16368|PRS4_CAEEL Probable 26S protease regulatory subunit 4 OS=Caenorhabditis elegans GN=rpt-2 PE=3 SV=1 400 653 5.0E-51
sp|Q8SSJ5|CDC48_ENCCU Cell division control protein 48 OS=Encephalitozoon cuniculi (strain GB-M1) GN=CDC48 PE=1 SV=1 405 634 5.0E-51
sp|O74445|PRS10_SCHPO Probable 26S protease subunit rpt4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpt4 PE=3 SV=2 405 652 8.0E-51
sp|Q01939|PRS8_YEAST 26S protease regulatory subunit 8 homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPT6 PE=1 SV=4 410 653 1.0E-50
sp|P46470|PRS8_XENLA 26S protease regulatory subunit 8 OS=Xenopus laevis GN=psmc5 PE=2 SV=2 410 664 1.0E-50
sp|Q8SQK0|PRS8_ENCCU 26S protease regulatory subunit 8 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPT6 PE=1 SV=2 407 653 1.0E-50
sp|Q9LZF6|CD48E_ARATH Cell division control protein 48 homolog E OS=Arabidopsis thaliana GN=CDC48E PE=1 SV=2 405 636 2.0E-50
sp|Q18787|PRS7_CAEEL 26S protease regulatory subunit 7 OS=Caenorhabditis elegans GN=rpt-1 PE=1 SV=1 405 660 2.0E-50
sp|Q58556|Y1156_METJA Cell division cycle protein 48 homolog MJ1156 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1156 PE=3 SV=1 405 634 3.0E-50
sp|Q07590|SAV_SULAC Protein SAV OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=sav PE=3 SV=2 404 642 3.0E-50
sp|Q9SL67|PRS4B_ARATH 26S proteasome regulatory subunit 4 homolog B OS=Arabidopsis thaliana GN=RPT2B PE=1 SV=1 407 653 5.0E-50
sp|Q25544|PRS8_NAEFO 26S protease regulatory subunit 8 homolog OS=Naegleria fowleri PE=2 SV=1 410 653 5.0E-50
sp|P53549|PRS10_YEAST 26S protease subunit RPT4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPT4 PE=1 SV=4 404 652 5.0E-50
sp|P33299|PRS7_YEAST 26S protease regulatory subunit 7 homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPT1 PE=1 SV=1 405 660 5.0E-50
sp|O88685|PRS6A_MOUSE 26S protease regulatory subunit 6A OS=Mus musculus GN=Psmc3 PE=1 SV=2 392 652 6.0E-50
sp|Q63569|PRS6A_RAT 26S protease regulatory subunit 6A OS=Rattus norvegicus GN=Psmc3 PE=2 SV=1 392 652 6.0E-50
sp|Q8SRH0|PRS4_ENCCU 26S protease regulatory subunit 4 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPT2 PE=1 SV=1 400 652 7.0E-50
sp|P17980|PRS6A_HUMAN 26S protease regulatory subunit 6A OS=Homo sapiens GN=PSMC3 PE=1 SV=3 392 652 8.0E-50
sp|Q96372|CDC48_CAPAN Cell division cycle protein 48 homolog OS=Capsicum annuum GN=CAFP PE=2 SV=1 405 651 9.0E-50
sp|Q54PJ1|PRS10_DICDI 26S protease regulatory subunit 10B OS=Dictyostelium discoideum GN=psmC6 PE=1 SV=1 397 652 1.0E-49
sp|Q9SZD4|PRS4A_ARATH 26S proteasome regulatory subunit 4 homolog A OS=Arabidopsis thaliana GN=RPT2A PE=1 SV=1 397 653 1.0E-49
sp|O42586|PR6AB_XENLA 26S protease regulatory subunit 6A-B OS=Xenopus laevis GN=psmc3-b PE=2 SV=1 392 652 2.0E-49
sp|O14126|PRS6A_SCHPO 26S protease regulatory subunit 6A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tbp1 PE=3 SV=1 392 652 2.0E-49
sp|O17071|PRS10_CAEEL Probable 26S protease regulatory subunit 10B OS=Caenorhabditis elegans GN=rpt-4 PE=1 SV=2 396 652 3.0E-49
sp|P46468|CDAT_PLAF7 Putative cell division cycle ATPase OS=Plasmodium falciparum (isolate 3D7) GN=PF07_0047 PE=3 SV=2 405 628 5.0E-49
sp|Q9SCN8|CD48D_ARATH Cell division control protein 48 homolog D OS=Arabidopsis thaliana GN=CDC48D PE=1 SV=1 405 636 7.0E-49
sp|P54774|CDC48_SOYBN Cell division cycle protein 48 homolog OS=Glycine max GN=CDC48 PE=2 SV=1 405 660 9.0E-49
sp|Q9SAJ3|FTSHC_ARATH ATP-dependent zinc metalloprotease FTSH 12, chloroplastic OS=Arabidopsis thaliana GN=FTSH12 PE=2 SV=2 422 831 1.0E-48
sp|Q55BV5|PRS4_DICDI 26S protease regulatory subunit 4 homolog OS=Dictyostelium discoideum GN=psmC1 PE=1 SV=1 397 653 1.0E-48
sp|P54609|CD48A_ARATH Cell division control protein 48 homolog A OS=Arabidopsis thaliana GN=CDC48A PE=1 SV=1 405 636 2.0E-48
sp|P36612|PRS4_SCHPO 26S protease regulatory subunit 4 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mts2 PE=2 SV=1 407 653 2.0E-48
sp|Q58556|Y1156_METJA Cell division cycle protein 48 homolog MJ1156 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1156 PE=3 SV=1 405 646 3.0E-48
sp|P46466|PRS4_ORYSJ 26S protease regulatory subunit 4 homolog OS=Oryza sativa subsp. japonica GN=TBP2 PE=2 SV=2 397 653 3.0E-48
sp|Q9LET7|CI111_ARATH Calmodulin-interacting protein 111 OS=Arabidopsis thaliana GN=CIP111 PE=1 SV=1 404 652 5.0E-48
sp|Q63570|PRS6B_RAT 26S protease regulatory subunit 6B OS=Rattus norvegicus GN=Psmc4 PE=1 SV=1 405 653 8.0E-48
sp|P54775|PRS6B_MOUSE 26S protease regulatory subunit 6B OS=Mus musculus GN=Psmc4 PE=1 SV=2 405 653 8.0E-48
sp|Q4R7L3|PRS6B_MACFA 26S protease regulatory subunit 6B OS=Macaca fascicularis GN=PSMC4 PE=2 SV=1 405 653 9.0E-48
sp|P43686|PRS6B_HUMAN 26S protease regulatory subunit 6B OS=Homo sapiens GN=PSMC4 PE=1 SV=2 405 653 9.0E-48
sp|Q3T030|PRS6B_BOVIN 26S protease regulatory subunit 6B OS=Bos taurus GN=PSMC4 PE=2 SV=1 405 653 9.0E-48
sp|P54812|TERA2_CAEEL Transitional endoplasmic reticulum ATPase homolog 2 OS=Caenorhabditis elegans GN=cdc-48.2 PE=1 SV=2 387 634 2.0E-47
sp|O05209|VAT_THEAC VCP-like ATPase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=vat PE=1 SV=1 400 634 2.0E-47
sp|Q7KN62|TERA_DROME Transitional endoplasmic reticulum ATPase TER94 OS=Drosophila melanogaster GN=TER94 PE=1 SV=1 400 634 2.0E-47
sp|P33298|PRS6B_YEAST 26S protease regulatory subunit 6B homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPT3 PE=1 SV=2 405 636 4.0E-47
sp|O28972|Y1297_ARCFU Cell division cycle protein 48 homolog AF_1297 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_1297 PE=3 SV=1 359 643 5.0E-47
sp|Q5AWS6|CDC48_EMENI Cell division control protein 48 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cdc48 PE=1 SV=2 405 634 8.0E-47
sp|O15381|NVL_HUMAN Nuclear valosin-containing protein-like OS=Homo sapiens GN=NVL PE=1 SV=1 405 663 1.0E-46
sp|Q9DBY8|NVL_MOUSE Nuclear valosin-containing protein-like OS=Mus musculus GN=Nvl PE=1 SV=1 405 663 2.0E-46
sp|Q6GL04|TERA_XENTR Transitional endoplasmic reticulum ATPase OS=Xenopus tropicalis GN=vcp PE=2 SV=1 404 634 2.0E-46
sp|Q54PN7|PRS6A_DICDI 26S protease regulatory subunit 6A homolog OS=Dictyostelium discoideum GN=psmC3 PE=1 SV=1 392 674 3.0E-46
sp|P23787|TERA_XENLA Transitional endoplasmic reticulum ATPase OS=Xenopus laevis GN=vcp PE=1 SV=3 404 634 4.0E-46
sp|P78578|PRS6B_ASPNG 26S protease regulatory subunit 6B homolog OS=Aspergillus niger GN=tbpA PE=3 SV=1 405 636 7.0E-46
sp|O74894|PRS6B_SCHPO 26S protease regulatory subunit 6B homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpt3 PE=3 SV=1 405 653 8.0E-46
sp|Q9HPF0|CDCH_HALSA Protein CdcH OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=cdcH PE=3 SV=1 405 634 9.0E-46
sp|Q9MAK9|PS10B_ARATH 26S protease regulatory subunit S10B homolog B OS=Arabidopsis thaliana GN=RPT4B PE=1 SV=1 405 652 1.0E-45
sp|P46462|TERA_RAT Transitional endoplasmic reticulum ATPase OS=Rattus norvegicus GN=Vcp PE=1 SV=3 404 632 1.0E-45
sp|Q01853|TERA_MOUSE Transitional endoplasmic reticulum ATPase OS=Mus musculus GN=Vcp PE=1 SV=4 404 632 1.0E-45
sp|P55072|TERA_HUMAN Transitional endoplasmic reticulum ATPase OS=Homo sapiens GN=VCP PE=1 SV=4 404 632 1.0E-45
sp|Q3ZBT1|TERA_BOVIN Transitional endoplasmic reticulum ATPase OS=Bos taurus GN=VCP PE=2 SV=1 404 632 1.0E-45
sp|Q9SEI3|PS10A_ARATH 26S protease regulatory subunit 10B homolog A OS=Arabidopsis thaliana GN=RPT4A PE=1 SV=1 405 652 2.0E-45
sp|Q9SEI4|PRS6B_ARATH 26S protease regulatory subunit 6B homolog OS=Arabidopsis thaliana GN=RPT3 PE=1 SV=1 405 647 3.0E-45
sp|P03974|TERA_PIG Transitional endoplasmic reticulum ATPase OS=Sus scrofa GN=VCP PE=1 SV=5 404 632 4.0E-45
sp|Q8SQI9|PRS6B_ENCCU 26S protease regulatory subunit 6B homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU08_1970 PE=1 SV=1 405 653 4.0E-45
sp|P46507|PRS6B_MANSE 26S protease regulatory subunit 6B OS=Manduca sexta PE=2 SV=1 392 647 4.0E-45
sp|Q7ZU99|TERA_DANRE Transitional endoplasmic reticulum ATPase OS=Danio rerio GN=vcp PE=1 SV=1 405 634 5.0E-45
sp|P85200|PRS6B_HELAN 26S protease regulatory subunit 6B homolog OS=Helianthus annuus PE=1 SV=1 405 647 6.0E-45
sp|Q3UMC0|SPAT5_MOUSE Spermatogenesis-associated protein 5 OS=Mus musculus GN=Spata5 PE=1 SV=2 405 652 9.0E-45
sp|O42587|PR6AA_XENLA 26S protease regulatory subunit 6A-A OS=Xenopus laevis GN=psmc3-a PE=2 SV=1 392 637 9.0E-45
sp|Q07590|SAV_SULAC Protein SAV OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=sav PE=3 SV=2 404 635 2.0E-44
sp|P54778|PRS6B_SOLTU 26S protease regulatory subunit 6B homolog OS=Solanum tuberosum PE=2 SV=1 405 647 2.0E-44
sp|Q9P3A7|CDC48_SCHPO Cell division cycle protein 48 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc48 PE=1 SV=2 405 644 2.0E-44
sp|P32794|AFG2_YEAST ATPase family gene 2 protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AFG2 PE=1 SV=1 404 656 2.0E-44
sp|Q8NB90|SPAT5_HUMAN Spermatogenesis-associated protein 5 OS=Homo sapiens GN=SPATA5 PE=1 SV=3 405 652 2.0E-44
sp|Q9LZF6|CD48E_ARATH Cell division control protein 48 homolog E OS=Arabidopsis thaliana GN=CDC48E PE=1 SV=2 394 643 3.0E-44
sp|Q9MUP8|YCF2_MESVI Protein Ycf2 OS=Mesostigma viride GN=ycf2 PE=3 SV=1 392 799 3.0E-44
sp|P54609|CD48A_ARATH Cell division control protein 48 homolog A OS=Arabidopsis thaliana GN=CDC48A PE=1 SV=1 394 643 4.0E-44
sp|P54811|TERA1_CAEEL Transitional endoplasmic reticulum ATPase homolog 1 OS=Caenorhabditis elegans GN=cdc-48.1 PE=1 SV=1 387 634 6.0E-44
sp|P25694|CDC48_YEAST Cell division control protein 48 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC48 PE=1 SV=3 387 650 8.0E-44
sp|P54774|CDC48_SOYBN Cell division cycle protein 48 homolog OS=Glycine max GN=CDC48 PE=2 SV=1 395 643 9.0E-44
sp|P25694|CDC48_YEAST Cell division control protein 48 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC48 PE=1 SV=3 404 646 1.0E-43
sp|P34123|PRS6B_DICDI 26S protease regulatory subunit 6B homolog OS=Dictyostelium discoideum GN=psmC4 PE=1 SV=1 407 647 1.0E-43
sp|Q6GL04|TERA_XENTR Transitional endoplasmic reticulum ATPase OS=Xenopus tropicalis GN=vcp PE=2 SV=1 400 643 2.0E-43
sp|P23787|TERA_XENLA Transitional endoplasmic reticulum ATPase OS=Xenopus laevis GN=vcp PE=1 SV=3 400 643 2.0E-43
sp|P34124|PRS8_DICDI 26S protease regulatory subunit 8 OS=Dictyostelium discoideum GN=psmC5 PE=1 SV=2 410 653 2.0E-43
sp|P46462|TERA_RAT Transitional endoplasmic reticulum ATPase OS=Rattus norvegicus GN=Vcp PE=1 SV=3 400 643 3.0E-43
sp|Q01853|TERA_MOUSE Transitional endoplasmic reticulum ATPase OS=Mus musculus GN=Vcp PE=1 SV=4 400 643 3.0E-43
sp|P55072|TERA_HUMAN Transitional endoplasmic reticulum ATPase OS=Homo sapiens GN=VCP PE=1 SV=4 400 643 3.0E-43
sp|Q3ZBT1|TERA_BOVIN Transitional endoplasmic reticulum ATPase OS=Bos taurus GN=VCP PE=2 SV=1 400 643 3.0E-43
sp|P03974|TERA_PIG Transitional endoplasmic reticulum ATPase OS=Sus scrofa GN=VCP PE=1 SV=5 400 643 3.0E-43
sp|Q7ZU99|TERA_DANRE Transitional endoplasmic reticulum ATPase OS=Danio rerio GN=vcp PE=1 SV=1 400 643 3.0E-43
sp|P54812|TERA2_CAEEL Transitional endoplasmic reticulum ATPase homolog 2 OS=Caenorhabditis elegans GN=cdc-48.2 PE=1 SV=2 404 643 4.0E-43
sp|Q9SCN8|CD48D_ARATH Cell division control protein 48 homolog D OS=Arabidopsis thaliana GN=CDC48D PE=1 SV=1 395 646 5.0E-43
sp|P41836|PRS8_SCHPO 26S protease regulatory subunit 8 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=let1 PE=3 SV=1 407 654 5.0E-43
sp|Q9P3A7|CDC48_SCHPO Cell division cycle protein 48 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc48 PE=1 SV=2 401 646 9.0E-43
sp|O60058|AFG2_SCHPO ATPase family gene 2 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=afg2 PE=3 SV=1 391 661 2.0E-42
sp|O05209|VAT_THEAC VCP-like ATPase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=vat PE=1 SV=1 405 652 3.0E-42
sp|O15381|NVL_HUMAN Nuclear valosin-containing protein-like OS=Homo sapiens GN=NVL PE=1 SV=1 405 633 4.0E-42
sp|Q9DBY8|NVL_MOUSE Nuclear valosin-containing protein-like OS=Mus musculus GN=Nvl PE=1 SV=1 391 633 4.0E-42
sp|P46502|PRS6B_CAEEL Probable 26S protease regulatory subunit 6B OS=Caenorhabditis elegans GN=rpt-3 PE=3 SV=1 405 653 5.0E-42
sp|Q5AWS6|CDC48_EMENI Cell division control protein 48 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cdc48 PE=1 SV=2 404 643 7.0E-42
sp|Q96372|CDC48_CAPAN Cell division cycle protein 48 homolog OS=Capsicum annuum GN=CAFP PE=2 SV=1 394 643 8.0E-42
sp|P54811|TERA1_CAEEL Transitional endoplasmic reticulum ATPase homolog 1 OS=Caenorhabditis elegans GN=cdc-48.1 PE=1 SV=1 400 643 1.0E-41
sp|Q7KN62|TERA_DROME Transitional endoplasmic reticulum ATPase TER94 OS=Drosophila melanogaster GN=TER94 PE=1 SV=1 386 643 2.0E-41
sp|O14325|YB7A_SCHPO Uncharacterized AAA domain-containing protein C16E9.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16E9.10c PE=1 SV=1 388 634 2.0E-41
sp|O14325|YB7A_SCHPO Uncharacterized AAA domain-containing protein C16E9.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16E9.10c PE=1 SV=1 405 635 5.0E-41
sp|Q8SSJ5|CDC48_ENCCU Cell division control protein 48 OS=Encephalitozoon cuniculi (strain GB-M1) GN=CDC48 PE=1 SV=1 354 660 1.0E-40
sp|Q54SY2|NVL_DICDI Putative ribosome biogenesis ATPase nvl OS=Dictyostelium discoideum GN=nvl PE=3 SV=1 405 659 1.0E-40
sp|Q9BVQ7|SPA5L_HUMAN Spermatogenesis-associated protein 5-like protein 1 OS=Homo sapiens GN=SPATA5L1 PE=1 SV=2 405 663 7.0E-39
sp|Q07844|RIX7_YEAST Ribosome biogenesis ATPase RIX7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RIX7 PE=1 SV=1 405 634 1.0E-38
sp|P56369|FTSHL_CHLVU ATP-dependent zinc metalloprotease FtsH homolog OS=Chlorella vulgaris GN=ftsH PE=3 SV=1 406 699 2.0E-37
sp|Q9FNP1|PEX1_ARATH Peroxisome biogenesis protein 1 OS=Arabidopsis thaliana GN=PEX1 PE=2 SV=2 404 634 3.0E-37
sp|Q9SS94|CD48C_ARATH Cell division control protein 48 homolog C OS=Arabidopsis thaliana GN=CDC48C PE=2 SV=2 376 668 3.0E-37
sp|Q5BL07|PEX1_MOUSE Peroxisome biogenesis factor 1 OS=Mus musculus GN=Pex1 PE=1 SV=2 389 635 3.0E-37
sp|Q8CDM1|ATAD2_MOUSE ATPase family AAA domain-containing protein 2 OS=Mus musculus GN=Atad2 PE=1 SV=1 405 634 5.0E-37
sp|P46468|CDAT_PLAF7 Putative cell division cycle ATPase OS=Plasmodium falciparum (isolate 3D7) GN=PF07_0047 PE=3 SV=2 405 630 8.0E-37
sp|P40340|TBP7_YEAST Tat-binding homolog 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YTA7 PE=1 SV=2 403 632 8.0E-37
sp|Q13608|PEX6_HUMAN Peroxisome assembly factor 2 OS=Homo sapiens GN=PEX6 PE=1 SV=2 383 641 2.0E-36
sp|Q5RDX4|ATAD2_PONAB ATPase family AAA domain-containing protein 2 OS=Pongo abelii GN=ATAD2 PE=2 SV=1 405 671 3.0E-36
sp|P54777|PEX6_RAT Peroxisome assembly factor 2 OS=Rattus norvegicus GN=Pex6 PE=1 SV=1 383 641 4.0E-36
sp|Q07844|RIX7_YEAST Ribosome biogenesis ATPase RIX7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RIX7 PE=1 SV=1 393 634 5.0E-36
sp|Q6PL18|ATAD2_HUMAN ATPase family AAA domain-containing protein 2 OS=Homo sapiens GN=ATAD2 PE=1 SV=1 405 671 5.0E-36
sp|Q9ULI0|ATD2B_HUMAN ATPase family AAA domain-containing protein 2B OS=Homo sapiens GN=ATAD2B PE=1 SV=3 405 634 5.0E-36
sp|Q99LC9|PEX6_MOUSE Peroxisome assembly factor 2 OS=Mus musculus GN=Pex6 PE=1 SV=1 383 641 7.0E-36
sp|A7YSY2|SPA5L_BOVIN Spermatogenesis-associated protein 5-like protein 1 OS=Bos taurus GN=SPATA5L1 PE=2 SV=1 405 663 2.0E-35
sp|P46463|PEX1_PICPA Peroxisome biosynthesis protein PAS1 OS=Komagataella pastoris GN=PEX1 PE=3 SV=1 405 671 2.0E-35
sp|O43933|PEX1_HUMAN Peroxisome biogenesis factor 1 OS=Homo sapiens GN=PEX1 PE=1 SV=1 410 635 2.0E-35
sp|O74941|PEX1_SCHPO Peroxisomal ATPase pex1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pex1 PE=3 SV=1 405 634 2.0E-35
sp|Q54SY2|NVL_DICDI Putative ribosome biogenesis ATPase nvl OS=Dictyostelium discoideum GN=nvl PE=3 SV=1 405 629 5.0E-35
sp|P33760|PEX6_YEAST Peroxisomal ATPase PEX6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEX6 PE=1 SV=1 404 632 5.0E-35
sp|Q9ZPR1|CD48B_ARATH Cell division control protein 48 homolog B OS=Arabidopsis thaliana GN=CDC48B PE=2 SV=1 404 648 5.0E-35
sp|O13764|PEX6_SCHPO Peroxisomal ATPase pex6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pex6 PE=3 SV=1 404 642 6.0E-35
sp|O60058|AFG2_SCHPO ATPase family gene 2 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=afg2 PE=3 SV=1 387 634 7.0E-35
sp|O61577|KTNA1_STRPU Katanin p60 ATPase-containing subunit A1 OS=Strongylocentrotus purpuratus GN=KATNA1 PE=1 SV=1 405 634 7.0E-35
sp|B5X3X5|KTNA1_SALSA Katanin p60 ATPase-containing subunit A1 OS=Salmo salar GN=katna1 PE=2 SV=1 405 634 8.0E-35
sp|Q3UMC0|SPAT5_MOUSE Spermatogenesis-associated protein 5 OS=Mus musculus GN=Spata5 PE=1 SV=2 387 634 9.0E-35
sp|Q8NB90|SPAT5_HUMAN Spermatogenesis-associated protein 5 OS=Homo sapiens GN=SPATA5 PE=1 SV=3 388 634 1.0E-34
sp|F4IAE9|Y1591_ARATH ATPase family AAA domain-containing protein At1g05910 OS=Arabidopsis thaliana GN=At1g05910 PE=2 SV=1 405 662 2.0E-34
sp|Q8RY16|PEX6_ARATH Peroxisome biogenesis protein 6 OS=Arabidopsis thaliana GN=PEX6 PE=1 SV=1 391 634 2.0E-34
sp|Q5XIK7|KATL1_RAT Katanin p60 ATPase-containing subunit A-like 1 OS=Rattus norvegicus GN=Katnal1 PE=1 SV=1 405 634 2.0E-34
sp|Q8K0T4|KATL1_MOUSE Katanin p60 ATPase-containing subunit A-like 1 OS=Mus musculus GN=Katnal1 PE=1 SV=1 405 634 2.0E-34
sp|Q0VA52|SPA5L_XENTR Spermatogenesis-associated protein 5-like protein 1 OS=Xenopus tropicalis GN=spata5l1 PE=2 SV=1 410 661 3.0E-34
sp|Q9UVU5|PEX6_PICAN Peroxisomal biogenesis factor 6 OS=Pichia angusta GN=PEX6 PE=1 SV=1 405 637 4.0E-34
sp|Q74Z13|PEX6_ASHGO Peroxisomal biogenesis factor 6 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PEX6 PE=3 SV=1 404 648 4.0E-34
sp|O14114|YEJJ_SCHPO Uncharacterized AAA domain-containing protein C31G5.19 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC31G5.19 PE=3 SV=1 373 630 5.0E-34
sp|Q5U3S1|KATL1_DANRE Katanin p60 ATPase-containing subunit A-like 1 OS=Danio rerio GN=katnal1 PE=2 SV=1 405 634 7.0E-34
sp|B7NZ88|KATL1_RABIT Katanin p60 ATPase-containing subunit A-like 1 OS=Oryctolagus cuniculus GN=KATNAL1 PE=3 SV=1 405 634 7.0E-34
sp|Q9BW62|KATL1_HUMAN Katanin p60 ATPase-containing subunit A-like 1 OS=Homo sapiens GN=KATNAL1 PE=1 SV=1 405 634 8.0E-34
sp|P24004|PEX1_YEAST Peroxisomal ATPase PEX1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEX1 PE=1 SV=2 405 630 9.0E-34
sp|Q54GX5|PEX1_DICDI Peroxisome biogenesis factor 1 OS=Dictyostelium discoideum GN=pex1 PE=3 SV=1 404 630 1.0E-33
sp|B4USW8|KATL1_OTOGA Katanin p60 ATPase-containing subunit A-like 1 OS=Otolemur garnettii GN=KATNAL1 PE=3 SV=1 405 634 1.0E-33
sp|A9RA82|KATL1_PAPAN Katanin p60 ATPase-containing subunit A-like 1 OS=Papio anubis GN=KATNAL1 PE=3 SV=1 405 634 1.0E-33
sp|Q9PUL2|KTNA1_XENLA Katanin p60 ATPase-containing subunit A1 (Fragment) OS=Xenopus laevis GN=katna1 PE=2 SV=1 405 652 1.0E-33
sp|Q0IIR9|KTNA1_XENTR Katanin p60 ATPase-containing subunit A1 OS=Xenopus tropicalis GN=katna1 PE=2 SV=1 405 652 1.0E-33
sp|Q1HGK7|KTNA1_CHICK Katanin p60 ATPase-containing subunit A1 OS=Gallus gallus GN=KATNA1 PE=2 SV=1 405 634 1.0E-33
sp|P52917|VPS4_YEAST Vacuolar protein sorting-associated protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS4 PE=1 SV=1 405 630 2.0E-33
sp|O75449|KTNA1_HUMAN Katanin p60 ATPase-containing subunit A1 OS=Homo sapiens GN=KATNA1 PE=1 SV=1 405 634 2.0E-33
sp|B3EX35|KATL1_SORAR Katanin p60 ATPase-containing subunit A-like 1 OS=Sorex araneus GN=KATNAL1 PE=3 SV=1 405 634 2.0E-33
sp|Q4R407|KTNA1_MACFA Katanin p60 ATPase-containing subunit A1 OS=Macaca fascicularis GN=KATNA1 PE=2 SV=1 405 634 3.0E-33
sp|Q6FW67|PEX6_CANGA Peroxisomal biogenesis factor 6 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PEX6 PE=3 SV=1 399 632 3.0E-33
sp|P54816|TBP7_CAEEL Tat-binding homolog 7 OS=Caenorhabditis elegans GN=lex-1 PE=1 SV=3 405 670 4.0E-33
sp|Q9C0W2|YHI5_SCHPO Uncharacterized AAA domain-containing protein P22H7.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pi026 PE=3 SV=1 405 634 4.0E-33
sp|Q6E0V2|KTNA1_RAT Katanin p60 ATPase-containing subunit A1 OS=Rattus norvegicus GN=Katna1 PE=1 SV=1 405 634 5.0E-33
sp|Q9WV86|KTNA1_MOUSE Katanin p60 ATPase-containing subunit A1 OS=Mus musculus GN=Katna1 PE=1 SV=1 405 634 5.0E-33
sp|Q9VQN8|FIGL1_DROME Fidgetin-like protein 1 OS=Drosophila melanogaster GN=CG3326 PE=2 SV=2 405 654 7.0E-33
sp|Q9ZNT0|VPS4_ARATH Protein SUPPRESSOR OF K(+) TRANSPORT GROWTH DEFECT 1 OS=Arabidopsis thaliana GN=SKD1 PE=1 SV=1 405 638 7.0E-33
sp|Q9LET7|CI111_ARATH Calmodulin-interacting protein 111 OS=Arabidopsis thaliana GN=CIP111 PE=1 SV=1 396 638 1.0E-32
sp|B7PXE3|SPAST_IXOSC Spastin OS=Ixodes scapularis GN=spas PE=3 SV=1 399 630 1.0E-32
sp|Q54CS8|PEX6_DICDI Peroxisomal biogenesis factor 6 OS=Dictyostelium discoideum GN=pex6 PE=3 SV=1 405 577 1.0E-32
sp|Q5RII9|KTNA1_DANRE Katanin p60 ATPase-containing subunit A1 OS=Danio rerio GN=katna1 PE=2 SV=1 405 634 2.0E-32
sp|Q6CPV1|PEX6_KLULA Peroxisomal biogenesis factor 6 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PEX6 PE=3 SV=1 404 672 2.0E-32
sp|Q9HG03|PEX6_PENCH Peroxisomal biogenesis factor 6 OS=Penicillium chrysogenum GN=pex6 PE=3 SV=1 391 642 2.0E-32
sp|P32794|AFG2_YEAST ATPase family gene 2 protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AFG2 PE=1 SV=1 405 645 3.0E-32
sp|O27092|PRS2_METTH Putative 26S protease regulatory subunit homolog MTH_1011 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=MTH_1011 PE=3 SV=1 405 655 4.0E-32
sp|A8X0L9|TBP7_CAEBR Tat-binding homolog 7 OS=Caenorhabditis briggsae GN=lex-1 PE=3 SV=2 405 670 6.0E-32
sp|Q9SS94|CD48C_ARATH Cell division control protein 48 homolog C OS=Arabidopsis thaliana GN=CDC48C PE=2 SV=2 405 652 8.0E-32
sp|B4JII0|SPAST_DROGR Spastin OS=Drosophila grimshawi GN=spas PE=3 SV=1 400 642 8.0E-32
sp|Q8FTE3|ARC_COREF AAA ATPase forming ring-shaped complexes OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=arc PE=3 SV=1 380 651 9.0E-32
sp|C3PGA0|ARC_CORA7 AAA ATPase forming ring-shaped complexes OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=arc PE=3 SV=1 391 690 1.0E-31
sp|Q5ZK92|SPAST_CHICK Spastin OS=Gallus gallus GN=SPAST PE=2 SV=1 400 630 1.0E-31
sp|P36966|PEX6_YARLI Peroxisomal biogenesis factor 6 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PEX6 PE=3 SV=2 405 640 1.0E-31
sp|A1A0U4|ARC_BIFAA AAA ATPase forming ring-shaped complexes OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=arc PE=3 SV=1 405 593 1.0E-31
sp|Q9BVQ7|SPA5L_HUMAN Spermatogenesis-associated protein 5-like protein 1 OS=Homo sapiens GN=SPATA5L1 PE=1 SV=2 430 632 2.0E-31
sp|Q6AZT2|SPAST_XENLA Spastin OS=Xenopus laevis GN=spast PE=2 SV=1 400 630 2.0E-31
sp|Q5AG40|VPS4_CANAL Vacuolar protein sorting-associated protein 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=VPS4 PE=2 SV=1 405 630 2.0E-31
sp|Q58889|PRS2_METJA Putative 26S protease regulatory subunit homolog MJ1494 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1494 PE=3 SV=2 372 655 2.0E-31
sp|P42811|PRS2_METTM Putative 26S protease regulatory subunit homolog MTBMA_c13930 OS=Methanothermobacter marburgensis (strain DSM 2133 / 14651 / NBRC 100331 / OCM 82 / Marburg) GN=MTBMA_c13930 PE=3 SV=1 405 650 3.0E-31
sp|Q60QD1|FIGL1_CAEBR Fidgetin-like protein 1 OS=Caenorhabditis briggsae GN=figl-1 PE=3 SV=1 404 640 6.0E-31
sp|Q9C1E9|PEX6_COLOR Peroxisomal biogenesis factor 6 OS=Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422) GN=PEX6 PE=3 SV=2 391 646 7.0E-31
sp|P46467|VPS4B_MOUSE Vacuolar protein sorting-associated protein 4B OS=Mus musculus GN=Vps4b PE=1 SV=2 405 634 9.0E-31
sp|B4M0H8|SPAST_DROVI Spastin OS=Drosophila virilis GN=spas PE=3 SV=1 400 642 1.0E-30
sp|Q9SEX2|KTNA1_ARATH Katanin p60 ATPase-containing subunit A1 OS=Arabidopsis thaliana GN=AAA1 PE=1 SV=1 400 652 1.0E-30
sp|Q298L4|SPAST_DROPS Spastin OS=Drosophila pseudoobscura pseudoobscura GN=spas PE=3 SV=1 400 661 1.0E-30
sp|Q6GX84|FIGL1_RAT Fidgetin-like protein 1 OS=Rattus norvegicus GN=Fignl1 PE=2 SV=1 405 630 1.0E-30
sp|Q8BPY9|FIGL1_MOUSE Fidgetin-like protein 1 OS=Mus musculus GN=Fignl1 PE=1 SV=1 405 630 1.0E-30
sp|Q09803|VPS4_SCHPO Suppressor protein of bem1/bed5 double mutants OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps4 PE=3 SV=1 405 634 1.0E-30
sp|B4K799|SPAST_DROMO Spastin OS=Drosophila mojavensis GN=spas PE=3 SV=1 400 641 2.0E-30
sp|B4G437|SPAST_DROPE Spastin OS=Drosophila persimilis GN=spas PE=3 SV=1 400 663 2.0E-30
sp|Q6DDU8|FIGL1_XENLA Fidgetin-like protein 1 OS=Xenopus laevis GN=fignl1 PE=2 SV=1 405 630 2.0E-30
sp|B2GIP2|ARC_KOCRD AAA ATPase forming ring-shaped complexes OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=arc PE=3 SV=1 391 604 3.0E-30
sp|Q719N1|SPAST_PIG Spastin (Fragment) OS=Sus scrofa GN=SPAST PE=2 SV=2 399 630 3.0E-30
sp|Q0VD48|VPS4B_BOVIN Vacuolar protein sorting-associated protein 4B OS=Bos taurus GN=VPS4B PE=2 SV=1 405 634 3.0E-30
sp|A4IHT0|FIGL1_XENTR Fidgetin-like protein 1 OS=Xenopus tropicalis GN=fignl1 PE=2 SV=1 405 630 3.0E-30
sp|Q8NQD8|ARC_CORGL AAA ATPase forming ring-shaped complexes OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=arc PE=3 SV=1 380 638 3.0E-30
sp|A4QE83|ARC_CORGB AAA ATPase forming ring-shaped complexes OS=Corynebacterium glutamicum (strain R) GN=arc PE=3 SV=1 380 638 3.0E-30
sp|O75351|VPS4B_HUMAN Vacuolar protein sorting-associated protein 4B OS=Homo sapiens GN=VPS4B PE=1 SV=2 405 634 3.0E-30
sp|B4NBP4|SPAST_DROWI Spastin OS=Drosophila willistoni GN=spas PE=3 SV=1 400 641 4.0E-30
sp|B3M301|SPAST_DROAN Spastin OS=Drosophila ananassae GN=spas PE=3 SV=1 399 641 4.0E-30
sp|Q6BS73|PEX6_DEBHA Peroxisomal biogenesis factor 6 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PEX6 PE=3 SV=2 405 640 4.0E-30
sp|A7YSY2|SPA5L_BOVIN Spermatogenesis-associated protein 5-like protein 1 OS=Bos taurus GN=SPATA5L1 PE=2 SV=1 430 632 5.0E-30
sp|Q5R658|VPS4B_PONAB Vacuolar protein sorting-associated protein 4B OS=Pongo abelii GN=VPS4B PE=2 SV=1 405 634 6.0E-30
sp|P28737|MSP1_YEAST Protein MSP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSP1 PE=1 SV=2 403 634 1.0E-29
sp|C6A7B2|ARC_BIFLB AAA ATPase forming ring-shaped complexes OS=Bifidobacterium animalis subsp. lactis (strain Bl-04 / DGCC2908 / RB 4825 / SD5219) GN=arc PE=3 SV=1 391 609 1.0E-29
sp|C6AHX0|ARC_BIFAS AAA ATPase forming ring-shaped complexes OS=Bifidobacterium animalis subsp. lactis (strain DSM 10140 / JCM 10602 / LMG 18314) GN=arc PE=3 SV=1 391 609 1.0E-29
sp|B8DTX4|ARC_BIFA0 AAA ATPase forming ring-shaped complexes OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=arc PE=3 SV=1 391 609 1.0E-29
sp|D3R4I7|ARC_BIFAB AAA ATPase forming ring-shaped complexes OS=Bifidobacterium animalis subsp. lactis (strain BB-12) GN=arc PE=3 SV=1 391 609 1.0E-29
sp|Q9UN37|VPS4A_HUMAN Vacuolar protein sorting-associated protein 4A OS=Homo sapiens GN=VPS4A PE=1 SV=1 405 634 1.0E-29
sp|P18759|SEC18_YEAST Vesicular-fusion protein SEC18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC18 PE=1 SV=2 370 632 1.0E-29
sp|Q793F9|VPS4A_RAT Vacuolar protein sorting-associated protein 4A OS=Rattus norvegicus GN=Vps4a PE=1 SV=1 405 634 2.0E-29
sp|Q8VEJ9|VPS4A_MOUSE Vacuolar protein sorting-associated protein 4A OS=Mus musculus GN=Vps4a PE=1 SV=1 405 634 2.0E-29
sp|Q05AS3|SPAST_XENTR Spastin OS=Xenopus tropicalis GN=spast PE=2 SV=1 400 630 2.0E-29
sp|Q6NW58|SPAST_DANRE Spastin OS=Danio rerio GN=spast PE=2 SV=2 400 630 2.0E-29
sp|D2Q9C6|ARC_BIFDB AAA ATPase forming ring-shaped complexes OS=Bifidobacterium dentium (strain ATCC 27534 / DSM 20436 / JCM 1195 / Bd1) GN=arc PE=3 SV=1 405 593 2.0E-29
sp|A2VDN5|SPAST_BOVIN Spastin OS=Bos taurus GN=SPAST PE=2 SV=1 400 630 2.0E-29
sp|Q7SGP2|PEX6_NEUCR Peroxisomal biogenesis factor 6 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pex-6 PE=3 SV=1 391 648 2.0E-29
sp|Q6PIW4|FIGL1_HUMAN Fidgetin-like protein 1 OS=Homo sapiens GN=FIGNL1 PE=1 SV=2 405 630 3.0E-29
sp|Q7QBW0|SPAST_ANOGA Spastin OS=Anopheles gambiae GN=spas PE=3 SV=6 400 641 4.0E-29
sp|Q6NH92|ARC_CORDI AAA ATPase forming ring-shaped complexes OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=arc PE=3 SV=1 391 649 4.0E-29
sp|B2RYN7|SPAST_RAT Spastin OS=Rattus norvegicus GN=Spast PE=1 SV=1 400 630 4.0E-29
sp|Q9QYY8|SPAST_MOUSE Spastin OS=Mus musculus GN=Spast PE=1 SV=3 400 630 5.0E-29
sp|O16299|FIGL1_CAEEL Fidgetin-like protein 1 OS=Caenorhabditis elegans GN=figl-1 PE=1 SV=1 404 641 6.0E-29
sp|P39955|SAP1_YEAST Protein SAP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAP1 PE=1 SV=1 394 665 8.0E-29
sp|P40328|TBP6_YEAST Probable 26S protease subunit YTA6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YTA6 PE=1 SV=2 404 659 1.0E-28
sp|F6QV99|ATAD1_BOVIN ATPase family AAA domain-containing protein 1 OS=Bos taurus GN=ATAD1 PE=2 SV=2 403 681 1.0E-28
sp|Q9D5T0|ATAD1_MOUSE ATPase family AAA domain-containing protein 1 OS=Mus musculus GN=Atad1 PE=1 SV=1 403 681 1.0E-28
sp|Q8NBU5|ATAD1_HUMAN ATPase family AAA domain-containing protein 1 OS=Homo sapiens GN=ATAD1 PE=1 SV=1 403 681 1.0E-28
sp|Q505J9|ATAD1_RAT ATPase family AAA domain-containing protein 1 OS=Rattus norvegicus GN=Atad1 PE=1 SV=1 403 681 1.0E-28
sp|Q54PT2|VPS4_DICDI Vacuolar protein sorting-associated protein 4 OS=Dictyostelium discoideum GN=vps4 PE=3 SV=1 405 635 1.0E-28
sp|Q9UBP0|SPAST_HUMAN Spastin OS=Homo sapiens GN=SPAST PE=1 SV=1 400 630 1.0E-28
sp|Q503W7|ATD1B_DANRE ATPase family AAA domain-containing protein 1-B OS=Danio rerio GN=atad1b PE=2 SV=2 402 676 2.0E-28
sp|F4J3N2|FTSI5_ARATH Probable inactive ATP-dependent zinc metalloprotease FTSHI 5, chloroplastic OS=Arabidopsis thaliana GN=FTSHI5 PE=2 SV=1 405 589 3.0E-28
sp|Q9P7Q4|SEC18_SCHPO Vesicular-fusion protein sec18 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec18 PE=1 SV=1 406 632 3.0E-28
sp|P33289|PEX6_PICPA Peroxisomal biogenesis factor 6 OS=Komagataella pastoris GN=PEX6 PE=3 SV=1 405 640 4.0E-28
sp|D2NT89|ARC_ROTMD AAA ATPase forming ring-shaped complexes OS=Rothia mucilaginosa (strain DY-18) GN=arc PE=3 SV=2 392 595 6.0E-28
sp|A0JMA9|KATL2_XENTR Katanin p60 ATPase-containing subunit A-like 2 OS=Xenopus tropicalis GN=katnal2 PE=2 SV=1 405 646 7.0E-28
sp|Q8I0P1|SPAST_DROME Spastin OS=Drosophila melanogaster GN=spas PE=1 SV=2 400 641 7.0E-28
sp|B3P8A3|SPAST_DROER Spastin OS=Drosophila erecta GN=spas PE=3 SV=1 400 641 8.0E-28
sp|B4HGG6|SPAST_DROSE Spastin OS=Drosophila sechellia GN=spas PE=3 SV=1 400 641 8.0E-28
sp|C5CBU4|ARC_MICLC AAA ATPase forming ring-shaped complexes OS=Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) GN=arc PE=3 SV=1 405 593 9.0E-28
sp|B4PL32|SPAST_DROYA Spastin OS=Drosophila yakuba GN=spas PE=3 SV=1 400 641 9.0E-28
sp|Q4JVP5|ARC_CORJK AAA ATPase forming ring-shaped complexes OS=Corynebacterium jeikeium (strain K411) GN=arc PE=3 SV=1 391 593 1.0E-27
sp|A8XV40|SPAST_CAEBR Probable spastin homolog spas-1 OS=Caenorhabditis briggsae GN=spas-1 PE=3 SV=2 405 634 2.0E-27
sp|Q8IYT4|KATL2_HUMAN Katanin p60 ATPase-containing subunit A-like 2 OS=Homo sapiens GN=KATNAL2 PE=2 SV=3 405 634 2.0E-27
sp|Q9D3R6|KATL2_MOUSE Katanin p60 ATPase-containing subunit A-like 2 OS=Mus musculus GN=Katnal2 PE=2 SV=2 405 634 3.0E-27
sp|Q9ZPR1|CD48B_ARATH Cell division control protein 48 homolog B OS=Arabidopsis thaliana GN=CDC48B PE=2 SV=1 408 698 7.0E-25
sp|Q0VA52|SPA5L_XENTR Spermatogenesis-associated protein 5-like protein 1 OS=Xenopus tropicalis GN=spata5l1 PE=2 SV=1 405 483 5.0E-09
sp|Q13608|PEX6_HUMAN Peroxisome assembly factor 2 OS=Homo sapiens GN=PEX6 PE=1 SV=2 412 633 1.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0004222 metalloendopeptidase activity Yes
GO:0005524 ATP binding Yes
GO:0008270 zinc ion binding Yes
GO:0006508 proteolysis Yes
GO:0017076 purine nucleotide binding No
GO:1901564 organonitrogen compound metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:0032555 purine ribonucleotide binding No
GO:0019538 protein metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032553 ribonucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0008233 peptidase activity No
GO:0044425 membrane part No
GO:0046914 transition metal ion binding No
GO:0140096 catalytic activity, acting on a protein No
GO:0031224 intrinsic component of membrane No
GO:0043170 macromolecule metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0070011 peptidase activity, acting on L-amino acid peptides No
GO:0071704 organic substance metabolic process No
GO:0004175 endopeptidase activity No
GO:0006807 nitrogen compound metabolic process No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0044238 primary metabolic process No
GO:0046872 metal ion binding No
GO:0008152 metabolic process No
GO:0043169 cation binding No
GO:0008150 biological_process No
GO:0036094 small molecule binding No
GO:0008144 drug binding No
GO:0003674 molecular_function No
GO:0008237 metallopeptidase activity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 239 261 22
2 351 373 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10191
MSRLFRQSNQLKQLLRLPRPSNLYRGSYLSPYPRSIRPGACATPYGLRTRYYSSKDSPPPRHDEDSQSNEDGKVK
KANEGEKGKDNEDGKVKEAKNGEDTAEPDGKSKPQQPLPEGWVHLTKQEIDQLDIFKDHLSTSQWEIVKGHKKAF
EEIGVPQELREVLRKMKDDPNGPGLMDTARLMRCVMKMSGQLAKWEVEQDKKKRDTAEEQDQPNNSGAGQQQEPG
QQGRRKEPLWMDIFQTIAVVAIVAYLSDMFIKPLAGKEITWQEMRRAFLDKGLVQKLVVVNGSQVRVELHPDAAE
ETSESGSTGRRTYVFSIGSVESFEKKLEEAQDQLGIPPSERIPVSYEAGGSSLGNLFLAFGPTLLFIGLIVWTQR
SMSGRTGGGGMFNFGKSKAKKFNAESAVKVKFADVAGLEEAKTEIMEFVSFLKQPEKFEKLGAKIPRGAILAGPP
GTGKTLLAKATAGESGVPFFSVSGSEFVEMFVGVGPSRVRDLFAEGRKNAPCIIFIDEIDAIGRARMDNNRGFGG
NDEREATLNQILTEMDGFNTREQVVVLAGTNRADILDKALMRPGRFDRHIFIDRPTMNGRKEIFRVYLKKIVTKE
DHDFLVGRLATLTPGFSGADISNVVNEAALIAARGNADDVKMEHFERAIERVIGGLERKSLVLKPEEKKTVAYHE
AGHAICGWFLRHADPLLKVSIIPRGQGALGYAQYLPQDAYLMNTNQLMDRMAMTMGGRVSEELHFPTVTTGASDD
FKKVSQLARNMVTQWGMSEKVGPVHFENNPNRMQKPFAEATAQQIDQEVHRIVEEAYRRCRDLLTQKKEEVGLVA
EELLKKEVLVRDDMVRLLGKRPFDDNDDFEKYFGGGKGESAPPPFPSETPSETDTPKDPPNPAPAFGRVDEGQER
QLR*
Coding >Hirsu2|10191
ATGTCAAGGCTTTTCCGACAATCGAACCAGCTCAAACAGCTACTACGACTGCCGCGCCCGTCAAACCTCTACCGG
GGCTCGTACTTGTCGCCATATCCCAGGTCGATCCGGCCAGGGGCCTGTGCAACGCCATACGGTCTTCGAACGAGA
TATTATTCCTCCAAAGATTCCCCGCCTCCAAGGCACGACGAAGACTCGCAGTCAAACGAAGACGGCAAGGTCAAG
AAGGCCAATGAGGGAGAGAAGGGGAAGGACAACGAAGATGGCAAGGTCAAGGAGGCCAAGAACGGAGAGGATACA
GCTGAGCCAGATGGGAAGTCCAAGCCGCAGCAGCCCCTGCCAGAAGGCTGGGTTCACTTGACCAAGCAGGAAATT
GATCAGCTCGACATCTTCAAAGATCACCTTTCCACGTCTCAGTGGGAAATTGTGAAGGGCCACAAGAAAGCGTTT
GAAGAAATCGGTGTGCCGCAAGAGCTTCGAGAGGTGCTTCGCAAAATGAAAGATGATCCCAATGGCCCGGGTCTA
ATGGACACGGCGAGGCTAATGCGATGCGTCATGAAGATGAGCGGGCAGCTGGCCAAGTGGGAGGTCGAACAAGAT
AAAAAGAAGCGCGACACAGCGGAAGAGCAAGACCAACCAAACAACTCCGGTGCAGGTCAACAACAAGAGCCAGGG
CAGCAGGGTCGCAGAAAAGAACCGCTTTGGATGGATATCTTCCAGACTATCGCTGTCGTTGCTATCGTCGCATAT
TTGTCCGATATGTTCATAAAGCCCCTCGCCGGAAAGGAGATTACCTGGCAGGAGATGCGCAGGGCCTTCCTAGAT
AAGGGCTTGGTCCAGAAGCTCGTGGTCGTCAATGGCTCGCAGGTAAGGGTAGAACTCCACCCGGATGCGGCCGAA
GAGACAAGCGAGTCGGGATCGACTGGCCGAAGGACATACGTCTTCTCCATTGGATCGGTCGAATCGTTCGAGAAG
AAGTTGGAGGAGGCTCAAGACCAGCTCGGTATTCCCCCGTCGGAAAGGATTCCGGTCAGCTACGAGGCTGGAGGC
AGTTCTCTTGGCAATCTCTTCCTTGCATTTGGACCGACGCTCCTGTTCATCGGCTTGATCGTGTGGACTCAGAGA
TCCATGAGCGGACGAACTGGAGGCGGCGGTATGTTCAACTTCGGCAAGAGCAAAGCGAAGAAGTTCAACGCCGAG
AGCGCGGTCAAGGTCAAGTTCGCGGATGTGGCCGGCCTCGAAGAAGCGAAGACGGAGATTATGGAGTTTGTCAGC
TTCCTGAAGCAGCCCGAGAAGTTTGAGAAGCTGGGAGCAAAGATCCCTCGCGGGGCCATCTTGGCCGGACCGCCG
GGTACCGGAAAGACGCTCCTCGCCAAGGCCACCGCCGGAGAGTCGGGGGTCCCGTTCTTCAGCGTCAGCGGATCC
GAGTTCGTGGAGATGTTTGTCGGTGTCGGACCGTCCAGGGTGCGCGACCTGTTCGCCGAGGGCCGCAAGAACGCG
CCGTGCATCATTTTCATCGACGAGATCGATGCCATTGGCCGGGCCAGAATGGACAACAACCGTGGCTTCGGCGGC
AATGACGAACGAGAGGCCACCCTGAACCAGATCCTGACGGAAATGGACGGCTTCAACACGCGAGAGCAGGTCGTG
GTTCTGGCCGGCACCAACCGCGCCGACATCCTGGACAAGGCTCTGATGCGGCCCGGTCGATTCGATCGACACATC
TTCATCGACCGCCCGACGATGAACGGGAGGAAGGAGATATTCAGGGTGTACCTCAAGAAGATCGTCACCAAGGAG
GACCACGACTTCCTCGTCGGACGACTGGCTACGCTGACCCCCGGATTCTCCGGCGCCGACATCTCCAACGTGGTC
AATGAGGCCGCCCTGATTGCGGCGAGGGGGAACGCGGACGACGTCAAGATGGAGCACTTCGAGCGCGCCATCGAG
CGAGTCATTGGCGGCCTGGAACGCAAGTCACTGGTGCTGAAGCCGGAGGAGAAGAAGACGGTGGCGTACCACGAA
GCCGGCCACGCCATCTGCGGCTGGTTCCTGCGACACGCGGATCCCCTGCTGAAGGTGTCCATCATTCCGCGCGGA
CAAGGCGCCTTGGGCTACGCGCAGTATCTGCCGCAGGACGCGTACCTGATGAACACGAACCAGTTGATGGACCGC
ATGGCCATGACCATGGGCGGGCGGGTATCGGAGGAACTTCACTTCCCCACGGTGACGACAGGGGCGAGCGACGAC
TTCAAGAAGGTGTCGCAGCTTGCACGCAACATGGTGACGCAGTGGGGCATGTCGGAGAAGGTGGGACCGGTGCAC
TTCGAGAACAACCCAAACCGAATGCAGAAACCGTTCGCGGAGGCGACGGCGCAGCAAATCGACCAGGAGGTGCAC
CGTATCGTGGAGGAGGCCTACAGGCGATGCAGGGATCTCCTGACGCAGAAGAAGGAGGAGGTCGGGCTCGTGGCA
GAGGAGCTGCTGAAGAAGGAGGTGCTGGTGCGGGATGACATGGTGCGGCTCCTGGGGAAGCGGCCGTTCGACGAC
AACGATGATTTCGAAAAGTATTTCGGCGGAGGCAAGGGGGAGAGCGCGCCGCCGCCGTTCCCTTCCGAGACGCCT
TCCGAGACGGATACGCCGAAGGACCCGCCGAACCCGGCGCCGGCCTTTGGGCGGGTCGACGAGGGACAGGAGAGG
CAGCTGCGGTGA
Transcript >Hirsu2|10191
ATGTCAAGGCTTTTCCGACAATCGAACCAGCTCAAACAGCTACTACGACTGCCGCGCCCGTCAAACCTCTACCGG
GGCTCGTACTTGTCGCCATATCCCAGGTCGATCCGGCCAGGGGCCTGTGCAACGCCATACGGTCTTCGAACGAGA
TATTATTCCTCCAAAGATTCCCCGCCTCCAAGGCACGACGAAGACTCGCAGTCAAACGAAGACGGCAAGGTCAAG
AAGGCCAATGAGGGAGAGAAGGGGAAGGACAACGAAGATGGCAAGGTCAAGGAGGCCAAGAACGGAGAGGATACA
GCTGAGCCAGATGGGAAGTCCAAGCCGCAGCAGCCCCTGCCAGAAGGCTGGGTTCACTTGACCAAGCAGGAAATT
GATCAGCTCGACATCTTCAAAGATCACCTTTCCACGTCTCAGTGGGAAATTGTGAAGGGCCACAAGAAAGCGTTT
GAAGAAATCGGTGTGCCGCAAGAGCTTCGAGAGGTGCTTCGCAAAATGAAAGATGATCCCAATGGCCCGGGTCTA
ATGGACACGGCGAGGCTAATGCGATGCGTCATGAAGATGAGCGGGCAGCTGGCCAAGTGGGAGGTCGAACAAGAT
AAAAAGAAGCGCGACACAGCGGAAGAGCAAGACCAACCAAACAACTCCGGTGCAGGTCAACAACAAGAGCCAGGG
CAGCAGGGTCGCAGAAAAGAACCGCTTTGGATGGATATCTTCCAGACTATCGCTGTCGTTGCTATCGTCGCATAT
TTGTCCGATATGTTCATAAAGCCCCTCGCCGGAAAGGAGATTACCTGGCAGGAGATGCGCAGGGCCTTCCTAGAT
AAGGGCTTGGTCCAGAAGCTCGTGGTCGTCAATGGCTCGCAGGTAAGGGTAGAACTCCACCCGGATGCGGCCGAA
GAGACAAGCGAGTCGGGATCGACTGGCCGAAGGACATACGTCTTCTCCATTGGATCGGTCGAATCGTTCGAGAAG
AAGTTGGAGGAGGCTCAAGACCAGCTCGGTATTCCCCCGTCGGAAAGGATTCCGGTCAGCTACGAGGCTGGAGGC
AGTTCTCTTGGCAATCTCTTCCTTGCATTTGGACCGACGCTCCTGTTCATCGGCTTGATCGTGTGGACTCAGAGA
TCCATGAGCGGACGAACTGGAGGCGGCGGTATGTTCAACTTCGGCAAGAGCAAAGCGAAGAAGTTCAACGCCGAG
AGCGCGGTCAAGGTCAAGTTCGCGGATGTGGCCGGCCTCGAAGAAGCGAAGACGGAGATTATGGAGTTTGTCAGC
TTCCTGAAGCAGCCCGAGAAGTTTGAGAAGCTGGGAGCAAAGATCCCTCGCGGGGCCATCTTGGCCGGACCGCCG
GGTACCGGAAAGACGCTCCTCGCCAAGGCCACCGCCGGAGAGTCGGGGGTCCCGTTCTTCAGCGTCAGCGGATCC
GAGTTCGTGGAGATGTTTGTCGGTGTCGGACCGTCCAGGGTGCGCGACCTGTTCGCCGAGGGCCGCAAGAACGCG
CCGTGCATCATTTTCATCGACGAGATCGATGCCATTGGCCGGGCCAGAATGGACAACAACCGTGGCTTCGGCGGC
AATGACGAACGAGAGGCCACCCTGAACCAGATCCTGACGGAAATGGACGGCTTCAACACGCGAGAGCAGGTCGTG
GTTCTGGCCGGCACCAACCGCGCCGACATCCTGGACAAGGCTCTGATGCGGCCCGGTCGATTCGATCGACACATC
TTCATCGACCGCCCGACGATGAACGGGAGGAAGGAGATATTCAGGGTGTACCTCAAGAAGATCGTCACCAAGGAG
GACCACGACTTCCTCGTCGGACGACTGGCTACGCTGACCCCCGGATTCTCCGGCGCCGACATCTCCAACGTGGTC
AATGAGGCCGCCCTGATTGCGGCGAGGGGGAACGCGGACGACGTCAAGATGGAGCACTTCGAGCGCGCCATCGAG
CGAGTCATTGGCGGCCTGGAACGCAAGTCACTGGTGCTGAAGCCGGAGGAGAAGAAGACGGTGGCGTACCACGAA
GCCGGCCACGCCATCTGCGGCTGGTTCCTGCGACACGCGGATCCCCTGCTGAAGGTGTCCATCATTCCGCGCGGA
CAAGGCGCCTTGGGCTACGCGCAGTATCTGCCGCAGGACGCGTACCTGATGAACACGAACCAGTTGATGGACCGC
ATGGCCATGACCATGGGCGGGCGGGTATCGGAGGAACTTCACTTCCCCACGGTGACGACAGGGGCGAGCGACGAC
TTCAAGAAGGTGTCGCAGCTTGCACGCAACATGGTGACGCAGTGGGGCATGTCGGAGAAGGTGGGACCGGTGCAC
TTCGAGAACAACCCAAACCGAATGCAGAAACCGTTCGCGGAGGCGACGGCGCAGCAAATCGACCAGGAGGTGCAC
CGTATCGTGGAGGAGGCCTACAGGCGATGCAGGGATCTCCTGACGCAGAAGAAGGAGGAGGTCGGGCTCGTGGCA
GAGGAGCTGCTGAAGAAGGAGGTGCTGGTGCGGGATGACATGGTGCGGCTCCTGGGGAAGCGGCCGTTCGACGAC
AACGATGATTTCGAAAAGTATTTCGGCGGAGGCAAGGGGGAGAGCGCGCCGCCGCCGTTCCCTTCCGAGACGCCT
TCCGAGACGGATACGCCGAAGGACCCGCCGAACCCGGCGCCGGCCTTTGGGCGGGTCGACGAGGGACAGGAGAGG
CAGCTGCGGTGA
Gene >Hirsu2|10191
ATGTCAAGGCTTTTCCGACAATCGAACCAGCTCAAACAGCTACTACGACTGCCGCGCCCGTCAAACCTCTACCGG
GGCTCGTACTTGTCGCCATATCCCAGGTCGATCCGGCCAGGGGCCTGTGCAACGCCATACGGTCTTCGAACGAGA
TATTATTCCTCCAAAGATTCCCCGCCTCCAAGGCACGACGAAGACTCGCAGTCAAACGAAGACGGCAAGGTCAAG
AAGGCCAATGAGGGAGAGAAGGGGAAGGACAACGAAGATGGCAAGGTCAAGGAGGCCAAGAACGGAGAGGATACA
GCTGAGCCAGATGGGAAGTCCAAGCCGCAGCAGCCCCTGCCAGAAGGCTGGGTTCACTTGACCAAGCAGGAAATT
GATCAGCTCGACATCTTCAAAGATCACCTTTCCACGTCTCAGTGGGAAATTGTGAAGGGCCACAAGAAAGCGTTT
GAAGAAATCGGTGTGCCGCAAGAGCTTCGAGAGGTGCTTCGCAAAATGAAAGATGATCCCAATGGCCCGGGTCTA
ATGGACACGGCGAGGCTAATGCGATGCGTCATGAAGATGAGCGGGCAGCTGGCCAAGTGGGAGGTCGAACAAGAT
AAAAAGAAGCGCGACACAGCGGAAGAGCAAGACCAACCAAACAACTCCGGTGCAGGTCAACAACAAGAGCCAGGG
CAGCAGGGTCGCAGAAAAGAACCGCTTTGGATGGATATCTTCCAGACTATCGCTGTCGTTGCTATCGTCGCATAT
TTGTCCGATATGTTCATAAAGCCCCTCGCCGGAAAGGAGATTACCTGGCAGGAGATGCGCAGGGCCTTCCTAGAT
AAGGGCTTGGTCCAGAAGCTCGTGGTCGTCAATGGCTCGCAGGTAAGGGTAGAACTCCACCCGGATGCGGCCGAA
GAGACAAGCGAGTCGGGATCGACTGGCCGAAGGACATACGTCTTCTCCATTGGATCGGTCGAATCGTTCGAGAAG
AAGTTGGAGGAGGCTCAAGACCAGCTCGGTATTCCCCCGTCGGAAAGGATTCCGGTCAGCTACGAGGCTGGAGGC
AGTTCTCTTGGCAATCTCTTCCTTGCATTTGGACCGACGCTCCTGTTCATCGGCTTGATCGTGTGGACTCAGAGA
TCCATGAGCGGACGAACTGGAGGCGGCGGTATGTTCAACTTCGGCAAGAGCAAAGCGAAGAAGTTCAACGCCGAG
AGCGCGGTCAAGGTCAAGTTCGCGGATGTGGCCGGCCTCGAAGAAGCGAAGACGGAGATTATGGAGTTTGTCAGC
TTCCTGAAGCAGCCCGAGAAGTTTGAGAAGCTGGGAGCAAAGATCCCTCGCGGGGCCATCTTGGCCGGACCGCCG
GGTACCGGAAAGACGCTCCTCGCCAAGGCCACCGCCGGAGAGTCGGGGGTCCCGTTCTTCAGCGTCAGCGGATCC
GAGTTCGTGGAGATGTTTGTCGGTGTCGGACCGTCCAGGGTGCGCGACCTGTTCGCCGAGGGCCGCAAGAACGCG
CCGTGCATCATTTTCATCGACGAGATCGATGCCATTGGCCGGGCCAGAATGGACAACAACCGTGGCTTCGGCGGC
AATGACGAACGAGAGGCCACCCTGAACCAGATCCTGACGGAAATGGACGGCTTCAACACGCGAGAGCAGGTCGTG
GTTCTGGCCGGCACCAACCGCGCCGACATCCTGGACAAGGCTCTGATGCGGCCCGGTCGATTCGATCGACACATC
TTCATCGACCGCCCGACGATGAACGGGAGGAAGGAGATATTCAGGGTGTACCTCAAGAAGATCGTCACCAAGGAG
GACCACGACTTCCTCGTCGGACGACTGGCTACGCTGACCCCCGGATTCTCCGGCGCCGACATCTCCAACGTGGTC
AATGAGGCCGCCCTGATTGGTACGTATTCATGGCAGATGACGGGGACCAAGGACAAAACAGCTAACGAGCGAACT
CGACAGCGGCGAGGGGGAACGCGGACGACGTCAAGATGGAGCACTTCGAGCGCGCCATCGAGCGAGTCATTGGCG
GCCTGGAACGCAAGTCACTGGTGCTGAAGCCGGAGGAGAAGAAGACGGTGGCGTACCACGAAGCCGGCCACGCCA
TCTGCGGCTGGTTCCTGCGACACGCGGATCCCCTGCTGAAGGTGTCCATCATTCCGCGCGGACAAGGCGCCTTGG
GCTACGCGCAGTATCTGCCGCAGGACGCGTACCTGATGAACACGAACCAGTTGATGGACCGCATGGCCATGACCA
TGGGCGGGCGGGTATCGGAGGAACTTCACTTCCCCACGGTGACGACAGGGGCGAGCGACGACTTCAAGAAGGTGT
CGCAGCTTGCACGCAACATGGTGACGCAGTGGGGCATGTCGGAGAAGGTGGGACCGGTGCACTTCGAGAACAACC
CAAACCGAATGCAGAAACCGTTCGCGGAGGCGACGGCGCAGCAAATCGACCAGGAGGTGCACCGTATCGTGGAGG
AGGCCTACAGGCGATGCAGGGATCTCCTGACGCAGAAGAAGGAGGAGGTCGGGCTCGTGGCAGAGGAGCTGCTGA
AGAAGGAGGTGCTGGTGCGGGATGACATGGTGCGGCTCCTGGGGAAGCGGCCGTTCGACGACAACGATGATTTCG
AAAAGTATTTCGGCGGAGGCAAGGGGGAGAGCGCGCCGCCGCCGTTCCCTTCCGAGACGCCTTCCGAGACGGATA
CGCCGAAGGACCCGCCGAACCCGGCGCCGGCCTTTGGGCGGGTCGACGAGGGACAGGAGAGGCAGCTGCGGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail