Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10188
Gene name
LocationContig_80:12467..13564
Strand-
Gene length (bp)1097
Transcript length (bp)960
Coding sequence length (bp)960
Protein length (aa) 320

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain 2.3E-52 35 217
PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain 6.6E-33 223 319
PF03435 Sacchrp_dh_NADP Saccharopine dehydrogenase NADP binding domain 1.1E-05 36 150

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q45223|HBD_BRADU 3-hydroxybutyryl-CoA dehydrogenase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=hbdA PE=3 SV=1 29 319 2.0E-89
sp|P45856|HBD_BACSU Probable 3-hydroxybutyryl-CoA dehydrogenase OS=Bacillus subtilis (strain 168) GN=mmgB PE=2 SV=1 31 319 4.0E-88
sp|Q9RVG1|HBD_DEIRA Probable 3-hydroxybutyryl-CoA dehydrogenase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=hbd PE=3 SV=1 35 319 7.0E-80
sp|P52041|HBD_CLOAB 3-hydroxybutyryl-CoA dehydrogenase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=hbd PE=1 SV=2 37 319 5.0E-79
sp|P77851|HBD_THETC 3-hydroxybutyryl-CoA dehydrogenase OS=Thermoanaerobacterium thermosaccharolyticum (strain ATCC 7956 / DSM 571 / NCIB 9385 / NCA 3814) GN=hbd PE=3 SV=2 37 319 2.0E-77
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q45223|HBD_BRADU 3-hydroxybutyryl-CoA dehydrogenase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=hbdA PE=3 SV=1 29 319 2.0E-89
sp|P45856|HBD_BACSU Probable 3-hydroxybutyryl-CoA dehydrogenase OS=Bacillus subtilis (strain 168) GN=mmgB PE=2 SV=1 31 319 4.0E-88
sp|Q9RVG1|HBD_DEIRA Probable 3-hydroxybutyryl-CoA dehydrogenase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=hbd PE=3 SV=1 35 319 7.0E-80
sp|P52041|HBD_CLOAB 3-hydroxybutyryl-CoA dehydrogenase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=hbd PE=1 SV=2 37 319 5.0E-79
sp|P77851|HBD_THETC 3-hydroxybutyryl-CoA dehydrogenase OS=Thermoanaerobacterium thermosaccharolyticum (strain ATCC 7956 / DSM 571 / NCIB 9385 / NCA 3814) GN=hbd PE=3 SV=2 37 319 2.0E-77
sp|P45364|HBD_PEPDI 3-hydroxybutyryl-CoA dehydrogenase OS=Peptoclostridium difficile GN=hbd PE=3 SV=1 35 319 3.0E-69
sp|Q61425|HCDH_MOUSE Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial OS=Mus musculus GN=Hadh PE=1 SV=2 32 319 3.0E-57
sp|Q9WVK7|HCDH_RAT Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Hadh PE=2 SV=1 32 319 5.0E-57
sp|P9WNP7|FADB2_MYCTU 3-hydroxybutyryl-CoA dehydrogenase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadB2 PE=1 SV=1 35 319 4.0E-56
sp|P9WNP6|FADB2_MYCTO 3-hydroxybutyryl-CoA dehydrogenase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadB2 PE=3 SV=1 35 319 4.0E-56
sp|Q16836|HCDH_HUMAN Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial OS=Homo sapiens GN=HADH PE=1 SV=3 32 319 6.0E-55
sp|P00348|HCDH_PIG Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial OS=Sus scrofa GN=HADH PE=1 SV=2 32 319 6.0E-55
sp|P76083|PAAH_ECOLI 3-hydroxyadipyl-CoA dehydrogenase OS=Escherichia coli (strain K12) GN=paaH PE=1 SV=1 31 319 4.0E-54
sp|P41938|HCDH2_CAEEL Probable 3-hydroxyacyl-CoA dehydrogenase B0272.3 OS=Caenorhabditis elegans GN=B0272.3 PE=3 SV=1 32 319 1.0E-51
sp|P34439|HCDH1_CAEEL Probable 3-hydroxyacyl-CoA dehydrogenase F54C8.1 OS=Caenorhabditis elegans GN=F54C8.1 PE=1 SV=1 24 319 3.0E-44
sp|A8A2L0|FADJ_ECOHS Fatty acid oxidation complex subunit alpha OS=Escherichia coli O9:H4 (strain HS) GN=fadJ PE=3 SV=1 30 319 2.0E-42
sp|A1S7L6|FADJ_SHEAM Fatty acid oxidation complex subunit alpha OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=fadJ PE=3 SV=1 47 319 2.0E-41
sp|A5WH99|FADB_PSYWF Fatty acid oxidation complex subunit alpha OS=Psychrobacter sp. (strain PRwf-1) GN=fadB PE=3 SV=1 16 319 1.0E-40
sp|A6WQ25|FADJ_SHEB8 Fatty acid oxidation complex subunit alpha OS=Shewanella baltica (strain OS185) GN=fadJ PE=3 SV=1 47 319 1.0E-40
sp|A3D684|FADJ_SHEB5 Fatty acid oxidation complex subunit alpha OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=fadJ PE=3 SV=1 47 319 1.0E-40
sp|A7MH81|FADJ_CROS8 Fatty acid oxidation complex subunit alpha OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=fadJ PE=3 SV=1 47 319 2.0E-40
sp|Q6FF68|FADB_ACIAD Fatty acid oxidation complex subunit alpha OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=fadB PE=3 SV=1 58 319 2.0E-40
sp|A1RI92|FADJ_SHESW Fatty acid oxidation complex subunit alpha OS=Shewanella sp. (strain W3-18-1) GN=fadJ PE=3 SV=1 47 319 2.0E-40
sp|A4Y897|FADJ_SHEPC Fatty acid oxidation complex subunit alpha OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=fadJ PE=3 SV=1 47 319 4.0E-40
sp|B2I2J9|FADB_ACIBC Fatty acid oxidation complex subunit alpha OS=Acinetobacter baumannii (strain ACICU) GN=fadB PE=3 SV=1 58 319 4.0E-40
sp|B0VLX4|FADB_ACIBS Fatty acid oxidation complex subunit alpha OS=Acinetobacter baumannii (strain SDF) GN=fadB PE=3 SV=1 58 319 4.0E-40
sp|B0VE45|FADB_ACIBY Fatty acid oxidation complex subunit alpha OS=Acinetobacter baumannii (strain AYE) GN=fadB PE=3 SV=1 58 319 7.0E-40
sp|B7I3P1|FADB_ACIB5 Fatty acid oxidation complex subunit alpha OS=Acinetobacter baumannii (strain AB0057) GN=fadB PE=3 SV=1 58 319 7.0E-40
sp|B7H1I0|FADB_ACIB3 Fatty acid oxidation complex subunit alpha OS=Acinetobacter baumannii (strain AB307-0294) GN=fadB PE=3 SV=1 58 319 7.0E-40
sp|A4VKA3|FADB_PSEU5 Fatty acid oxidation complex subunit alpha OS=Pseudomonas stutzeri (strain A1501) GN=fadB PE=3 SV=1 58 319 8.0E-40
sp|A4WCW6|FADJ_ENT38 Fatty acid oxidation complex subunit alpha OS=Enterobacter sp. (strain 638) GN=fadJ PE=3 SV=1 47 319 1.0E-39
sp|Q48GW3|FADB_PSE14 Fatty acid oxidation complex subunit alpha OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=fadB PE=3 SV=1 58 319 1.0E-39
sp|Q4ZRA0|FADB_PSEU2 Fatty acid oxidation complex subunit alpha OS=Pseudomonas syringae pv. syringae (strain B728a) GN=fadB PE=3 SV=1 58 319 3.0E-39
sp|A3QFP3|FADJ_SHELP Fatty acid oxidation complex subunit alpha OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=fadJ PE=3 SV=1 47 319 4.0E-39
sp|A4XSM8|FADB_PSEMY Fatty acid oxidation complex subunit alpha OS=Pseudomonas mendocina (strain ymp) GN=fadB PE=3 SV=1 58 319 5.0E-39
sp|Q1I7D4|FADB_PSEE4 Fatty acid oxidation complex subunit alpha OS=Pseudomonas entomophila (strain L48) GN=fadB PE=3 SV=1 58 319 5.0E-39
sp|B0TL21|FADJ_SHEHH Fatty acid oxidation complex subunit alpha OS=Shewanella halifaxensis (strain HAW-EB4) GN=fadJ PE=3 SV=1 47 319 6.0E-39
sp|B5FEW8|FADB_VIBFM Fatty acid oxidation complex subunit alpha OS=Vibrio fischeri (strain MJ11) GN=fadB PE=3 SV=1 57 319 6.0E-39
sp|Q5E8X6|FADB_VIBF1 Fatty acid oxidation complex subunit alpha OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=fadB PE=3 SV=1 57 319 1.0E-38
sp|B1J5A5|FADB_PSEPW Fatty acid oxidation complex subunit alpha OS=Pseudomonas putida (strain W619) GN=fadB PE=3 SV=1 58 319 1.0E-38
sp|Q9AHY3|FADB_PSEPU Fatty acid oxidation complex subunit alpha OS=Pseudomonas putida GN=fadB PE=3 SV=2 58 319 1.0E-38
sp|Q93Q12|FADB_PSEOL Fatty acid oxidation complex subunit alpha OS=Pseudomonas oleovorans GN=fadB PE=3 SV=1 58 319 1.0E-38
sp|Q87ZB2|FADB_PSESM Fatty acid oxidation complex subunit alpha OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=fadB PE=3 SV=1 58 319 1.0E-38
sp|B5FPN1|FADJ_SALDC Fatty acid oxidation complex subunit alpha OS=Salmonella dublin (strain CT_02021853) GN=fadJ PE=3 SV=1 48 319 1.0E-38
sp|Q9HZJ2|FADB_PSEAE Fatty acid oxidation complex subunit alpha OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=fadB PE=3 SV=1 58 319 1.0E-38
sp|Q02PH8|FADB_PSEAB Fatty acid oxidation complex subunit alpha OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=fadB PE=3 SV=1 58 319 1.0E-38
sp|B7UYR6|FADB_PSEA8 Fatty acid oxidation complex subunit alpha OS=Pseudomonas aeruginosa (strain LESB58) GN=fadB PE=3 SV=1 58 319 1.0E-38
sp|Q1Q8J9|FADB_PSYCK Fatty acid oxidation complex subunit alpha OS=Psychrobacter cryohalolentis (strain K5) GN=fadB PE=3 SV=1 25 319 1.0E-38
sp|Q8ECP7|FADJ_SHEON Fatty acid oxidation complex subunit alpha OS=Shewanella oneidensis (strain MR-1) GN=fadJ PE=3 SV=2 47 319 2.0E-38
sp|A1RDW6|FADB_SHESW Fatty acid oxidation complex subunit alpha OS=Shewanella sp. (strain W3-18-1) GN=fadB PE=3 SV=1 58 319 2.0E-38
sp|A4Y1B6|FADB_SHEPC Fatty acid oxidation complex subunit alpha OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=fadB PE=3 SV=1 58 319 2.0E-38
sp|B0KH74|FADB_PSEPG Fatty acid oxidation complex subunit alpha OS=Pseudomonas putida (strain GB-1) GN=fadB PE=3 SV=1 58 319 2.0E-38
sp|Q0HKD1|FADJ_SHESM Fatty acid oxidation complex subunit alpha OS=Shewanella sp. (strain MR-4) GN=fadJ PE=3 SV=1 47 319 2.0E-38
sp|A6V382|FADB_PSEA7 Fatty acid oxidation complex subunit alpha OS=Pseudomonas aeruginosa (strain PA7) GN=fadB PE=3 SV=1 58 319 2.0E-38
sp|A0KV76|FADJ_SHESA Fatty acid oxidation complex subunit alpha OS=Shewanella sp. (strain ANA-3) GN=fadJ PE=3 SV=1 47 319 2.0E-38
sp|A3CYJ4|FADB_SHEB5 Fatty acid oxidation complex subunit alpha OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=fadB PE=3 SV=1 58 319 2.0E-38
sp|B5R3R9|FADJ_SALEP Fatty acid oxidation complex subunit alpha OS=Salmonella enteritidis PT4 (strain P125109) GN=fadJ PE=3 SV=1 48 319 2.0E-38
sp|B4SZR0|FADJ_SALNS Fatty acid oxidation complex subunit alpha OS=Salmonella newport (strain SL254) GN=fadJ PE=3 SV=1 48 319 3.0E-38
sp|Q8Z4Z0|FADJ_SALTI Fatty acid oxidation complex subunit alpha OS=Salmonella typhi GN=fadJ PE=3 SV=1 48 319 3.0E-38
sp|B5BBA1|FADJ_SALPK Fatty acid oxidation complex subunit alpha OS=Salmonella paratyphi A (strain AKU_12601) GN=fadJ PE=3 SV=1 48 319 3.0E-38
sp|Q5PCX6|FADJ_SALPA Fatty acid oxidation complex subunit alpha OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=fadJ PE=3 SV=1 48 319 3.0E-38
sp|B4TCA8|FADJ_SALHS Fatty acid oxidation complex subunit alpha OS=Salmonella heidelberg (strain SL476) GN=fadJ PE=3 SV=1 48 319 3.0E-38
sp|B5EZR9|FADJ_SALA4 Fatty acid oxidation complex subunit alpha OS=Salmonella agona (strain SL483) GN=fadJ PE=3 SV=1 48 319 3.0E-38
sp|Q88L02|FADB_PSEPK Fatty acid oxidation complex subunit alpha OS=Pseudomonas putida (strain KT2440) GN=fadB PE=3 SV=1 58 319 3.0E-38
sp|Q8ZNA7|FADJ_SALTY Fatty acid oxidation complex subunit alpha OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fadJ PE=3 SV=1 48 319 3.0E-38
sp|Q0HWN3|FADJ_SHESR Fatty acid oxidation complex subunit alpha OS=Shewanella sp. (strain MR-7) GN=fadJ PE=3 SV=1 47 319 3.0E-38
sp|B4TQC2|FADJ_SALSV Fatty acid oxidation complex subunit alpha OS=Salmonella schwarzengrund (strain CVM19633) GN=fadJ PE=3 SV=1 48 319 3.0E-38
sp|A9N453|FADJ_SALPB Fatty acid oxidation complex subunit alpha OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=fadJ PE=3 SV=1 48 319 3.0E-38
sp|A6WHA0|FADB_SHEB8 Fatty acid oxidation complex subunit alpha OS=Shewanella baltica (strain OS185) GN=fadB PE=3 SV=1 58 319 4.0E-38
sp|B8E3R3|FADB_SHEB2 Fatty acid oxidation complex subunit alpha OS=Shewanella baltica (strain OS223) GN=fadB PE=3 SV=1 58 319 4.0E-38
sp|Q57LW6|FADJ_SALCH Fatty acid oxidation complex subunit alpha OS=Salmonella choleraesuis (strain SC-B67) GN=fadJ PE=3 SV=1 48 319 4.0E-38
sp|A9KU91|FADB_SHEB9 Fatty acid oxidation complex subunit alpha OS=Shewanella baltica (strain OS195) GN=fadB PE=3 SV=1 58 319 4.0E-38
sp|Q6D2L7|FADJ_PECAS Fatty acid oxidation complex subunit alpha OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=fadJ PE=3 SV=1 48 319 4.0E-38
sp|B7LLD0|FADJ_ESCF3 Fatty acid oxidation complex subunit alpha OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=fadJ PE=3 SV=1 48 319 6.0E-38
sp|Q4FQC6|FADB_PSYA2 Fatty acid oxidation complex subunit alpha OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=fadB PE=3 SV=1 57 319 7.0E-38
sp|A5W6H0|FADB_PSEP1 Fatty acid oxidation complex subunit alpha OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=fadB PE=3 SV=1 58 319 1.0E-37
sp|P28793|FADB_PSEFR Fatty acid oxidation complex subunit alpha OS=Pseudomonas fragi GN=fadB PE=1 SV=1 58 319 1.0E-37
sp|B5RCL3|FADJ_SALG2 Fatty acid oxidation complex subunit alpha OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=fadJ PE=3 SV=1 48 319 1.0E-37
sp|P07896|ECHP_RAT Peroxisomal bifunctional enzyme OS=Rattus norvegicus GN=Ehhadh PE=1 SV=2 29 319 2.0E-37
sp|Q07ZP8|FADJ_SHEFN Fatty acid oxidation complex subunit alpha OS=Shewanella frigidimarina (strain NCIMB 400) GN=fadJ PE=3 SV=1 47 319 3.0E-37
sp|Q3K9D8|FADB_PSEPF Fatty acid oxidation complex subunit alpha OS=Pseudomonas fluorescens (strain Pf0-1) GN=fadB PE=3 SV=1 58 319 3.0E-37
sp|Q4KFC4|FADB_PSEF5 Fatty acid oxidation complex subunit alpha OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=fadB PE=3 SV=1 58 319 3.0E-37
sp|C6DAL7|FADJ_PECCP Fatty acid oxidation complex subunit alpha OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=fadJ PE=3 SV=1 48 319 4.0E-37
sp|B6EGU2|FADB_ALISL Fatty acid oxidation complex subunit alpha OS=Aliivibrio salmonicida (strain LFI1238) GN=fadB PE=3 SV=1 57 319 6.0E-37
sp|C3K613|FADB_PSEFS Fatty acid oxidation complex subunit alpha OS=Pseudomonas fluorescens (strain SBW25) GN=fadB PE=3 SV=1 58 319 6.0E-37
sp|P77399|FADJ_ECOLI Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain K12) GN=fadJ PE=1 SV=1 48 319 7.0E-37
sp|B1X9L4|FADJ_ECODH Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain K12 / DH10B) GN=fadJ PE=3 SV=1 48 319 7.0E-37
sp|C4ZVN2|FADJ_ECOBW Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=fadJ PE=3 SV=1 48 319 7.0E-37
sp|Q5QXH7|FADB_IDILO Fatty acid oxidation complex subunit alpha OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=fadB PE=3 SV=1 57 319 1.0E-36
sp|A7ZPF8|FADJ_ECO24 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=fadJ PE=3 SV=1 48 319 1.0E-36
sp|B6I6Q4|FADJ_ECOSE Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain SE11) GN=fadJ PE=3 SV=1 48 319 1.0E-36
sp|Q32DJ4|FADJ_SHIDS Fatty acid oxidation complex subunit alpha OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=fadJ PE=3 SV=1 48 319 1.0E-36
sp|Q31YB7|FADJ_SHIBS Fatty acid oxidation complex subunit alpha OS=Shigella boydii serotype 4 (strain Sb227) GN=fadJ PE=3 SV=1 48 319 1.0E-36
sp|B1IXA5|FADJ_ECOLC Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=fadJ PE=3 SV=1 48 319 2.0E-36
sp|B2TWV4|FADJ_SHIB3 Fatty acid oxidation complex subunit alpha OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=fadJ PE=3 SV=1 48 319 2.0E-36
sp|Q8XCP2|FADJ_ECO57 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O157:H7 GN=fadJ PE=3 SV=1 48 319 2.0E-36
sp|Q5R5M8|ECHP_PONAB Peroxisomal bifunctional enzyme OS=Pongo abelii GN=EHHADH PE=2 SV=1 29 319 2.0E-36
sp|B5YXY4|FADJ_ECO5E Fatty acid oxidation complex subunit alpha OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=fadJ PE=3 SV=1 48 319 2.0E-36
sp|A4STF2|FADB_AERS4 Fatty acid oxidation complex subunit alpha OS=Aeromonas salmonicida (strain A449) GN=fadB PE=3 SV=1 57 319 2.0E-36
sp|B7N5V2|FADJ_ECOLU Fatty acid oxidation complex subunit alpha OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=fadJ PE=3 SV=1 48 319 2.0E-36
sp|A8ADP2|FADJ_CITK8 Fatty acid oxidation complex subunit alpha OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=fadJ PE=3 SV=1 47 319 2.0E-36
sp|Q0TFA6|FADJ_ECOL5 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=fadJ PE=3 SV=1 48 319 2.0E-36
sp|Q1R972|FADJ_ECOUT Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain UTI89 / UPEC) GN=fadJ PE=3 SV=1 48 319 3.0E-36
sp|A1ADI8|FADJ_ECOK1 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O1:K1 / APEC GN=fadJ PE=3 SV=1 48 319 3.0E-36
sp|B7UFZ8|FADJ_ECO27 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=fadJ PE=3 SV=1 48 319 3.0E-36
sp|B7MGV7|FADJ_ECO45 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=fadJ PE=3 SV=1 48 319 3.0E-36
sp|Q8FFG4|FADJ_ECOL6 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fadJ PE=3 SV=1 48 319 4.0E-36
sp|Q9DBM2|ECHP_MOUSE Peroxisomal bifunctional enzyme OS=Mus musculus GN=Ehhadh PE=1 SV=4 29 319 4.0E-36
sp|Q0T2E6|FADJ_SHIF8 Fatty acid oxidation complex subunit alpha OS=Shigella flexneri serotype 5b (strain 8401) GN=fadJ PE=3 SV=1 48 319 5.0E-36
sp|Q3YZM2|FADJ_SHISS Fatty acid oxidation complex subunit alpha OS=Shigella sonnei (strain Ss046) GN=fadJ PE=3 SV=1 48 319 5.0E-36
sp|Q83QQ0|FADJ_SHIFL Fatty acid oxidation complex subunit alpha OS=Shigella flexneri GN=fadJ PE=3 SV=1 48 319 5.0E-36
sp|B7NP24|FADJ_ECO7I Fatty acid oxidation complex subunit alpha OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=fadJ PE=3 SV=1 48 319 1.0E-35
sp|Q1CHK2|FADJ_YERPN Fatty acid oxidation complex subunit alpha OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=fadJ PE=3 SV=2 47 319 1.0E-35
sp|Q8ZD45|FADJ_YERPE Fatty acid oxidation complex subunit alpha OS=Yersinia pestis GN=fadJ PE=3 SV=2 47 319 1.0E-35
sp|Q1C660|FADJ_YERPA Fatty acid oxidation complex subunit alpha OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=fadJ PE=3 SV=2 47 319 1.0E-35
sp|A7FGK1|FADJ_YERP3 Fatty acid oxidation complex subunit alpha OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=fadJ PE=3 SV=1 47 319 1.0E-35
sp|Q08426|ECHP_HUMAN Peroxisomal bifunctional enzyme OS=Homo sapiens GN=EHHADH PE=1 SV=3 29 319 1.0E-35
sp|B7MY16|FADJ_ECO81 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O81 (strain ED1a) GN=fadJ PE=3 SV=1 48 319 1.0E-35
sp|Q668V1|FADJ_YERPS Fatty acid oxidation complex subunit alpha OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=fadJ PE=3 SV=2 47 319 1.0E-35
sp|A4TM82|FADJ_YERPP Fatty acid oxidation complex subunit alpha OS=Yersinia pestis (strain Pestoides F) GN=fadJ PE=3 SV=1 47 319 1.0E-35
sp|Q08A39|FADB_SHEFN Fatty acid oxidation complex subunit alpha OS=Shewanella frigidimarina (strain NCIMB 400) GN=fadB PE=3 SV=1 58 319 2.0E-35
sp|Q7MZ92|FADB_PHOLL Fatty acid oxidation complex subunit alpha OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=fadB PE=3 SV=1 53 319 2.0E-35
sp|B7M6M2|FADJ_ECO8A Fatty acid oxidation complex subunit alpha OS=Escherichia coli O8 (strain IAI1) GN=fadJ PE=3 SV=1 48 319 5.0E-35
sp|Q9ZPI5|MFP2_ARATH Peroxisomal fatty acid beta-oxidation multifunctional protein MFP2 OS=Arabidopsis thaliana GN=MFP2 PE=1 SV=1 32 319 6.0E-35
sp|B7LBJ5|FADJ_ECO55 Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain 55989 / EAEC) GN=fadJ PE=3 SV=1 48 319 7.0E-35
sp|P55100|ECHP_CAVPO Peroxisomal bifunctional enzyme OS=Cavia porcellus GN=EHHADH PE=2 SV=2 29 319 1.0E-34
sp|A1S1I8|FADB_SHEAM Fatty acid oxidation complex subunit alpha OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=fadB PE=3 SV=1 58 319 1.0E-34
sp|Q6LW06|FADB_PHOPR Fatty acid oxidation complex subunit alpha OS=Photobacterium profundum GN=fadB PE=3 SV=1 57 319 1.0E-34
sp|A1JIG4|FADB_YERE8 Fatty acid oxidation complex subunit alpha OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=fadB PE=3 SV=1 57 319 1.0E-34
sp|B1LME7|FADJ_ECOSM Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=fadJ PE=3 SV=1 48 319 2.0E-34
sp|B7VGL4|FADB_VIBTL Fatty acid oxidation complex subunit alpha OS=Vibrio tasmaniensis (strain LGP32) GN=fadB PE=3 SV=1 57 319 2.0E-34
sp|Q3YVC1|FADB_SHISS Fatty acid oxidation complex subunit alpha OS=Shigella sonnei (strain Ss046) GN=fadB PE=3 SV=1 57 319 2.0E-34
sp|P21177|FADB_ECOLI Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain K12) GN=fadB PE=1 SV=2 57 319 2.0E-34
sp|B1XAK8|FADB_ECODH Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain K12 / DH10B) GN=fadB PE=3 SV=1 57 319 2.0E-34
sp|C5A020|FADB_ECOBW Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=fadB PE=3 SV=1 57 319 2.0E-34
sp|Q83PG1|FADB_SHIFL Fatty acid oxidation complex subunit alpha OS=Shigella flexneri GN=fadB PE=3 SV=4 57 319 3.0E-34
sp|Q0SZ36|FADB_SHIF8 Fatty acid oxidation complex subunit alpha OS=Shigella flexneri serotype 5b (strain 8401) GN=fadB PE=3 SV=1 57 319 3.0E-34
sp|Q66FR8|FADB_YERPS Fatty acid oxidation complex subunit alpha OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=fadB PE=3 SV=1 57 319 3.0E-34
sp|B2K0Z6|FADB_YERPB Fatty acid oxidation complex subunit alpha OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=fadB PE=3 SV=1 57 319 3.0E-34
sp|A8GH86|FADJ_SERP5 Fatty acid oxidation complex subunit alpha OS=Serratia proteamaculans (strain 568) GN=fadJ PE=3 SV=2 48 319 3.0E-34
sp|B1JP63|FADB_YERPY Fatty acid oxidation complex subunit alpha OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=fadB PE=3 SV=1 57 319 4.0E-34
sp|A4TR27|FADB_YERPP Fatty acid oxidation complex subunit alpha OS=Yersinia pestis (strain Pestoides F) GN=fadB PE=3 SV=1 57 319 4.0E-34
sp|Q1CN99|FADB_YERPN Fatty acid oxidation complex subunit alpha OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=fadB PE=3 SV=1 57 319 4.0E-34
sp|A9R754|FADB_YERPG Fatty acid oxidation complex subunit alpha OS=Yersinia pestis bv. Antiqua (strain Angola) GN=fadB PE=3 SV=1 57 319 4.0E-34
sp|Q8ZAN0|FADB_YERPE Fatty acid oxidation complex subunit alpha OS=Yersinia pestis GN=fadB PE=3 SV=1 57 319 4.0E-34
sp|Q1C2C4|FADB_YERPA Fatty acid oxidation complex subunit alpha OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=fadB PE=3 SV=1 57 319 4.0E-34
sp|A7FDF2|FADB_YERP3 Fatty acid oxidation complex subunit alpha OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=fadB PE=3 SV=1 57 319 4.0E-34
sp|B7NFE7|FADB_ECOLU Fatty acid oxidation complex subunit alpha OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=fadB PE=3 SV=1 57 319 5.0E-34
sp|B7NV20|FADB_ECO7I Fatty acid oxidation complex subunit alpha OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=fadB PE=3 SV=1 57 319 5.0E-34
sp|B5XVW2|FADJ_KLEP3 Fatty acid oxidation complex subunit alpha OS=Klebsiella pneumoniae (strain 342) GN=fadJ PE=3 SV=1 34 319 6.0E-34
sp|A8G8D1|FADB_SERP5 Fatty acid oxidation complex subunit alpha OS=Serratia proteamaculans (strain 568) GN=fadB PE=3 SV=1 57 319 6.0E-34
sp|B5YY93|FADB_ECO5E Fatty acid oxidation complex subunit alpha OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=fadB PE=3 SV=1 57 319 8.0E-34
sp|Q8X8I2|FADB_ECO57 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O157:H7 GN=fadB PE=3 SV=1 57 319 8.0E-34
sp|P40939|ECHA_HUMAN Trifunctional enzyme subunit alpha, mitochondrial OS=Homo sapiens GN=HADHA PE=1 SV=2 23 319 1.0E-33
sp|A7N1D2|FADB_VIBCB Fatty acid oxidation complex subunit alpha OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=fadB PE=3 SV=1 57 319 1.0E-33
sp|B0TLB9|FADB_SHEHH Fatty acid oxidation complex subunit alpha OS=Shewanella halifaxensis (strain HAW-EB4) GN=fadB PE=3 SV=1 58 319 1.0E-33
sp|Q0I0T3|FADB_SHESR Fatty acid oxidation complex subunit alpha OS=Shewanella sp. (strain MR-7) GN=fadB PE=3 SV=1 58 319 1.0E-33
sp|A1JK30|FADJ_YERE8 Fatty acid oxidation complex subunit alpha OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=fadJ PE=3 SV=2 47 319 2.0E-33
sp|Q8EKR9|FADB_SHEON Fatty acid oxidation complex subunit alpha OS=Shewanella oneidensis (strain MR-1) GN=fadB PE=3 SV=1 58 319 2.0E-33
sp|Q87TN9|FADB_VIBPA Fatty acid oxidation complex subunit alpha OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=fadB PE=3 SV=1 57 319 2.0E-33
sp|Q7MQH9|FADB_VIBVY Fatty acid oxidation complex subunit alpha OS=Vibrio vulnificus (strain YJ016) GN=fadB PE=3 SV=1 57 319 2.0E-33
sp|Q8DDK6|FADB_VIBVU Fatty acid oxidation complex subunit alpha OS=Vibrio vulnificus (strain CMCP6) GN=fadB PE=3 SV=1 57 319 2.0E-33
sp|A0KR50|FADB_SHESA Fatty acid oxidation complex subunit alpha OS=Shewanella sp. (strain ANA-3) GN=fadB PE=3 SV=1 58 319 2.0E-33
sp|Q0HPB7|FADB_SHESM Fatty acid oxidation complex subunit alpha OS=Shewanella sp. (strain MR-4) GN=fadB PE=3 SV=1 58 319 2.0E-33
sp|O49809|MFPA_BRANA Glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a OS=Brassica napus PE=2 SV=2 32 319 3.0E-33
sp|Q29554|ECHA_PIG Trifunctional enzyme subunit alpha, mitochondrial OS=Sus scrofa GN=HADHA PE=1 SV=1 23 319 4.0E-33
sp|Q7N288|FADJ_PHOLL Fatty acid oxidation complex subunit alpha OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=fadJ PE=3 SV=2 48 319 5.0E-33
sp|Q6DAP5|FADB_PECAS Fatty acid oxidation complex subunit alpha OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=fadB PE=3 SV=1 57 319 2.0E-32
sp|A6TC19|FADJ_KLEP7 Fatty acid oxidation complex subunit alpha OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=fadJ PE=3 SV=1 47 319 3.0E-32
sp|Q8DB47|FADJ_VIBVU Fatty acid oxidation complex subunit alpha OS=Vibrio vulnificus (strain CMCP6) GN=fadJ PE=3 SV=1 46 319 4.0E-32
sp|Q7MIS5|FADJ_VIBVY Fatty acid oxidation complex subunit alpha OS=Vibrio vulnificus (strain YJ016) GN=fadJ PE=3 SV=1 46 319 4.0E-32
sp|Q9ZPI6|AIM1_ARATH Peroxisomal fatty acid beta-oxidation multifunctional protein AIM1 OS=Arabidopsis thaliana GN=AIM1 PE=1 SV=1 32 319 6.0E-32
sp|Q8W1L6|MFP_ORYSJ Peroxisomal fatty acid beta-oxidation multifunctional protein OS=Oryza sativa subsp. japonica GN=MFP PE=1 SV=2 35 319 7.0E-32
sp|Q8BMS1|ECHA_MOUSE Trifunctional enzyme subunit alpha, mitochondrial OS=Mus musculus GN=Hadha PE=1 SV=1 23 319 7.0E-32
sp|Q5QXM1|FADJ_IDILO Fatty acid oxidation complex subunit alpha OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=fadJ PE=3 SV=1 47 319 7.0E-32
sp|Q64428|ECHA_RAT Trifunctional enzyme subunit alpha, mitochondrial OS=Rattus norvegicus GN=Hadha PE=1 SV=2 32 319 9.0E-32
sp|A5F465|FADB_VIBC3 Fatty acid oxidation complex subunit alpha OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=fadB PE=3 SV=1 57 319 9.0E-32
sp|C3LSI3|FADB_VIBCM Fatty acid oxidation complex subunit alpha OS=Vibrio cholerae serotype O1 (strain M66-2) GN=fadB PE=3 SV=1 57 319 9.0E-32
sp|Q9KNI1|FADB_VIBCH Fatty acid oxidation complex subunit alpha OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fadB PE=3 SV=1 57 319 9.0E-32
sp|Q6NYL3|ECHP_DANRE Peroxisomal bifunctional enzyme OS=Danio rerio GN=ehhadh PE=2 SV=1 31 319 2.0E-31
sp|Q489W3|FADB_COLP3 Fatty acid oxidation complex subunit alpha OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=fadB PE=3 SV=1 58 319 2.0E-31
sp|B7UNH4|FADB_ECO27 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=fadB PE=3 SV=1 37 319 4.0E-31
sp|A3Q8U4|FADB_SHELP Fatty acid oxidation complex subunit alpha OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=fadB PE=3 SV=1 58 319 7.0E-31
sp|A7MS61|FADJ_VIBCB Fatty acid oxidation complex subunit alpha OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=fadJ PE=3 SV=1 47 319 1.0E-30
sp|Q87MM3|FADJ_VIBPA Fatty acid oxidation complex subunit alpha OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=fadJ PE=3 SV=1 47 319 2.0E-30
sp|Q6LTK3|FADJ_PHOPR Fatty acid oxidation complex subunit alpha OS=Photobacterium profundum GN=fadJ PE=3 SV=1 47 319 2.0E-30
sp|Q39659|MFPA_CUCSA Glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a OS=Cucumis sativus PE=1 SV=1 32 319 5.0E-30
sp|Q9KT58|FADJ_VIBCH Fatty acid oxidation complex subunit alpha OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fadJ PE=3 SV=2 47 319 1.0E-29
sp|A5F2P2|FADJ_VIBC3 Fatty acid oxidation complex subunit alpha OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=fadJ PE=3 SV=1 47 319 1.0E-29
sp|A0KEL1|FADB_AERHH Fatty acid oxidation complex subunit alpha OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=fadB PE=3 SV=1 57 319 1.0E-29
sp|B7N2F2|FADB_ECO81 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O81 (strain ED1a) GN=fadB PE=3 SV=1 57 319 5.0E-29
sp|Q1R466|FADB_ECOUT Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain UTI89 / UPEC) GN=fadB PE=3 SV=2 57 319 5.0E-29
sp|B7MHD1|FADB_ECO45 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=fadB PE=3 SV=1 57 319 5.0E-29
sp|Q5E3U1|FADJ_VIBF1 Fatty acid oxidation complex subunit alpha OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=fadJ PE=3 SV=2 47 319 8.0E-29
sp|A7MQP0|FADB_CROS8 Fatty acid oxidation complex subunit alpha OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=fadB PE=3 SV=1 57 319 1.0E-28
sp|A8GYG0|FADB_SHEPA Fatty acid oxidation complex subunit alpha OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=fadB PE=3 SV=1 58 319 2.0E-28
sp|A8A6V1|FADB_ECOHS Fatty acid oxidation complex subunit alpha OS=Escherichia coli O9:H4 (strain HS) GN=fadB PE=3 SV=1 57 319 2.0E-28
sp|B4TNZ1|FADB_SALSV Fatty acid oxidation complex subunit alpha OS=Salmonella schwarzengrund (strain CVM19633) GN=fadB PE=3 SV=1 57 319 2.0E-28
sp|B4SZ85|FADB_SALNS Fatty acid oxidation complex subunit alpha OS=Salmonella newport (strain SL254) GN=fadB PE=3 SV=1 57 319 3.0E-28
sp|B5RFL6|FADB_SALG2 Fatty acid oxidation complex subunit alpha OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=fadB PE=3 SV=1 57 319 3.0E-28
sp|B5QW85|FADB_SALEP Fatty acid oxidation complex subunit alpha OS=Salmonella enteritidis PT4 (strain P125109) GN=fadB PE=3 SV=1 57 319 3.0E-28
sp|Q32A21|FADB_SHIDS Fatty acid oxidation complex subunit alpha OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=fadB PE=3 SV=1 57 319 3.0E-28
sp|B1KCZ3|FADB_SHEWM Fatty acid oxidation complex subunit alpha OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=fadB PE=3 SV=1 58 319 3.0E-28
sp|A9MYB0|FADB_SALPB Fatty acid oxidation complex subunit alpha OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=fadB PE=3 SV=1 57 319 3.0E-28
sp|Q57HM6|FADB_SALCH Fatty acid oxidation complex subunit alpha OS=Salmonella choleraesuis (strain SC-B67) GN=fadB PE=3 SV=2 57 319 3.0E-28
sp|B5EZW0|FADB_SALA4 Fatty acid oxidation complex subunit alpha OS=Salmonella agona (strain SL483) GN=fadB PE=3 SV=1 57 319 3.0E-28
sp|B5BIZ0|FADB_SALPK Fatty acid oxidation complex subunit alpha OS=Salmonella paratyphi A (strain AKU_12601) GN=fadB PE=3 SV=1 57 319 4.0E-28
sp|Q5PKQ2|FADB_SALPA Fatty acid oxidation complex subunit alpha OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=fadB PE=3 SV=1 57 319 4.0E-28
sp|B2TVJ5|FADB_SHIB3 Fatty acid oxidation complex subunit alpha OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=fadB PE=3 SV=1 57 319 4.0E-28
sp|B1IW61|FADB_ECOLC Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=fadB PE=3 SV=1 57 319 4.0E-28
sp|B7M649|FADB_ECO8A Fatty acid oxidation complex subunit alpha OS=Escherichia coli O8 (strain IAI1) GN=fadB PE=3 SV=1 57 319 4.0E-28
sp|B7L9A7|FADB_ECO55 Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain 55989 / EAEC) GN=fadB PE=3 SV=1 57 319 4.0E-28
sp|B6I4I6|FADB_ECOSE Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain SE11) GN=fadB PE=3 SV=1 57 319 5.0E-28
sp|B1LM32|FADB_ECOSM Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=fadB PE=3 SV=1 57 319 5.0E-28
sp|A8ACZ4|FADB_CITK8 Fatty acid oxidation complex subunit alpha OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=fadB PE=3 SV=1 57 319 5.0E-28
sp|A7ZU51|FADB_ECO24 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=fadB PE=3 SV=1 57 319 5.0E-28
sp|B7LTY9|FADB_ESCF3 Fatty acid oxidation complex subunit alpha OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=fadB PE=3 SV=1 57 319 5.0E-28
sp|B8CH91|FADB_SHEPW Fatty acid oxidation complex subunit alpha OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=fadB PE=3 SV=1 58 319 5.0E-28
sp|Q9L6L5|FADB_SALTY Fatty acid oxidation complex subunit alpha OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fadB PE=3 SV=1 57 319 6.0E-28
sp|Q9F0Y7|FADB_ENTCL Fatty acid oxidation complex subunit alpha OS=Enterobacter cloacae GN=fadB PE=3 SV=1 57 319 6.0E-28
sp|B5XYH0|FADB_KLEP3 Fatty acid oxidation complex subunit alpha OS=Klebsiella pneumoniae (strain 342) GN=fadB PE=3 SV=1 57 319 6.0E-28
sp|A6TGM4|FADB_KLEP7 Fatty acid oxidation complex subunit alpha OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=fadB PE=3 SV=1 57 319 7.0E-28
sp|A8FP63|FADB_SHESH Fatty acid oxidation complex subunit alpha OS=Shewanella sediminis (strain HAW-EB3) GN=fadB PE=3 SV=1 58 319 8.0E-28
sp|A4WFX4|FADB_ENT38 Fatty acid oxidation complex subunit alpha OS=Enterobacter sp. (strain 638) GN=fadB PE=3 SV=1 57 319 9.0E-28
sp|Q8Z3C6|FADB_SALTI Fatty acid oxidation complex subunit alpha OS=Salmonella typhi GN=fadB PE=3 SV=1 57 319 1.0E-27
sp|Q8FBI2|FADB_ECOL6 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fadB PE=3 SV=2 57 319 2.0E-27
sp|Q0TAL0|FADB_ECOL5 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=fadB PE=3 SV=1 57 319 2.0E-27
sp|O32178|FADN_BACSU Probable 3-hydroxyacyl-CoA dehydrogenase OS=Bacillus subtilis (strain 168) GN=fadN PE=2 SV=2 37 317 7.0E-20
sp|Q9ZCZ1|FAD3_RICPR Putative fatty acid oxidation complex trifunctional enzyme OS=Rickettsia prowazekii (strain Madrid E) GN=RP560 PE=3 SV=1 31 317 9.0E-15
sp|Q4UL32|FAD3_RICFE Putative fatty acid oxidation complex trifunctional enzyme OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0890 PE=3 SV=1 31 317 1.0E-14
sp|P83589|HCDH_DEIRA Probable 3-hydroxyacyl-CoA dehydrogenase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=DR_2477 PE=1 SV=2 37 317 8.0E-14
sp|Q68WH7|FAD3_RICTY Putative fatty acid oxidation complex trifunctional enzyme OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=RT0547 PE=3 SV=1 31 317 2.0E-12
sp|Q63MT0|LCDH_BURPS L-carnitine dehydrogenase OS=Burkholderia pseudomallei (strain K96243) GN=lcdH PE=3 SV=1 110 261 8.0E-12
sp|Q62DG4|LCDH_BURMA L-carnitine dehydrogenase OS=Burkholderia mallei (strain ATCC 23344) GN=lcdH PE=3 SV=2 110 261 9.0E-12
sp|P76083|PAAH_ECOLI 3-hydroxyadipyl-CoA dehydrogenase OS=Escherichia coli (strain K12) GN=paaH PE=1 SV=1 203 299 2.0E-11
sp|Q98CR3|LCDH_RHILO L-carnitine dehydrogenase OS=Rhizobium loti (strain MAFF303099) GN=lcdH PE=3 SV=1 105 258 1.0E-10
sp|Q88R32|LCDH_PSEPK L-carnitine dehydrogenase OS=Pseudomonas putida (strain KT2440) GN=lcdH PE=3 SV=1 30 261 2.0E-10
sp|B1VLT7|LCDH_STRGG L-carnitine dehydrogenase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=lcdH PE=3 SV=1 104 266 6.0E-10
sp|D7URM0|LCDH_PSESP L-carnitine dehydrogenase OS=Pseudomonas sp. GN=lcdH PE=1 SV=1 94 261 6.0E-10
sp|D7B2S5|LCDH_NOCDD L-carnitine dehydrogenase OS=Nocardiopsis dassonvillei (strain ATCC 23218 / DSM 43111 / IMRU 509 / JCM 7437 / NCTC 10488) GN=lcdH PE=3 SV=1 105 261 7.0E-10
sp|Q4V182|LCDH_BACCZ L-carnitine dehydrogenase OS=Bacillus cereus (strain ZK / E33L) GN=lcdH PE=3 SV=1 74 281 9.0E-10
sp|Q9HTH8|LCDH_PSEAE L-carnitine dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=lcdH PE=1 SV=1 30 261 6.0E-09
sp|Q4ZSC0|LCDH_PSEU2 L-carnitine dehydrogenase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=lcdH PE=3 SV=1 97 261 1.0E-08
sp|Q5LTH8|LCDH_RUEPO L-carnitine dehydrogenase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=lcdH PE=3 SV=1 108 261 2.0E-08
sp|Q5RDZ2|CRYL1_PONAB Lambda-crystallin homolog OS=Pongo abelii GN=CRYL1 PE=2 SV=3 33 267 3.0E-08
sp|Q9Y2S2|CRYL1_HUMAN Lambda-crystallin homolog OS=Homo sapiens GN=CRYL1 PE=1 SV=3 33 267 3.0E-08
sp|Q8CUW0|LCDH_OCEIH L-carnitine dehydrogenase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=lcdH PE=3 SV=1 108 266 3.0E-08
sp|Q92NF5|LCDH_RHIME L-carnitine dehydrogenase OS=Rhizobium meliloti (strain 1021) GN=lcdH PE=3 SV=1 108 256 4.0E-08
sp|Q8CQB9|LCDH_STAES L-carnitine dehydrogenase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=lcdH PE=3 SV=1 35 252 5.0E-08
sp|D7UNT2|LCDH_RHISP L-carnitine dehydrogenase OS=Rhizobium sp. GN=lcdH PE=1 SV=1 108 256 7.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0006631 fatty acid metabolic process Yes
GO:0016491 oxidoreductase activity Yes
GO:0003857 3-hydroxyacyl-CoA dehydrogenase activity Yes
GO:0055114 oxidation-reduction process Yes
GO:0071704 organic substance metabolic process No
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor No
GO:0003674 molecular_function No
GO:0044255 cellular lipid metabolic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0043436 oxoacid metabolic process No
GO:0044238 primary metabolic process No
GO:0006629 lipid metabolic process No
GO:0009987 cellular process No
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors No
GO:0019752 carboxylic acid metabolic process No
GO:0044237 cellular metabolic process No
GO:0006082 organic acid metabolic process No
GO:0003824 catalytic activity No
GO:0032787 monocarboxylic acid metabolic process No
GO:0044281 small molecule metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10188
MASSLFRTRAPGAAAQQARLFSCSARRHAADVGSLGVIGAGQMGLGIALVAAQKARVPVTLIDTSDAALKKGLAF
ADKLLAKDVSKSRITQEQADEARSRLKPSTKMEDLSSVDFVIEAVPEIPKLKFEIFGNLAKMCAKHAILATNTSS
ISITRIAAATTSDPTDTSASSRVVSTHFMNPVPVQKGVEIISGLQTSKETLDRAVEFCKKMGKVASVSTDSPGFL
ANRILMPYINEAVICLETGVGDRDSIDAIMKNGTNVPMGPLQLADFIGLDTCLSIMKVLHEETGDSKYRPSVLLG
KMVDAGWLGKKSGKGFYDY*
Coding >Hirsu2|10188
ATGGCGAGCTCACTTTTCCGGACGCGAGCCCCCGGGGCGGCGGCACAGCAGGCGCGCCTCTTCAGCTGCTCCGCG
CGACGGCACGCGGCAGACGTGGGCAGCCTCGGCGTCATCGGAGCCGGTCAGATGGGACTGGGCATTGCCTTGGTG
GCGGCTCAGAAGGCGCGCGTGCCCGTCACGCTCATCGACACGTCCGACGCGGCGCTGAAGAAGGGCCTGGCGTTT
GCCGACAAGCTGCTGGCCAAGGACGTGTCCAAGTCGAGGATTACGCAGGAGCAGGCGGACGAGGCGCGGTCGCGG
CTGAAGCCGAGCACGAAGATGGAGGACCTCTCATCGGTCGACTTCGTGATCGAGGCGGTGCCGGAGATACCCAAG
CTCAAGTTCGAGATCTTCGGCAACCTGGCCAAGATGTGCGCCAAGCACGCGATCCTGGCGACCAACACGTCGTCC
ATCTCCATCACGCGCATCGCGGCGGCGACGACGTCGGATCCGACGGACACGTCGGCGTCGTCGCGCGTCGTGTCG
ACGCACTTTATGAACCCGGTGCCGGTGCAGAAGGGCGTCGAGATCATCAGCGGCCTCCAGACGAGCAAGGAGACG
CTGGACCGGGCGGTCGAGTTCTGCAAGAAGATGGGCAAGGTCGCCTCCGTGTCGACCGACTCCCCGGGCTTTCTG
GCCAACCGAATCCTGATGCCGTACATCAACGAGGCCGTCATCTGCCTGGAGACGGGGGTCGGGGATCGCGACTCG
ATCGACGCCATCATGAAGAACGGGACTAACGTGCCGATGGGCCCGCTCCAGCTTGCCGATTTCATCGGGCTGGAC
ACATGCCTGTCGATCATGAAGGTTCTGCACGAGGAGACGGGTGACTCCAAGTACAGACCGAGTGTCCTGCTCGGC
AAGATGGTCGATGCCGGCTGGCTGGGGAAGAAGAGCGGCAAGGGCTTCTACGACTACTGA
Transcript >Hirsu2|10188
ATGGCGAGCTCACTTTTCCGGACGCGAGCCCCCGGGGCGGCGGCACAGCAGGCGCGCCTCTTCAGCTGCTCCGCG
CGACGGCACGCGGCAGACGTGGGCAGCCTCGGCGTCATCGGAGCCGGTCAGATGGGACTGGGCATTGCCTTGGTG
GCGGCTCAGAAGGCGCGCGTGCCCGTCACGCTCATCGACACGTCCGACGCGGCGCTGAAGAAGGGCCTGGCGTTT
GCCGACAAGCTGCTGGCCAAGGACGTGTCCAAGTCGAGGATTACGCAGGAGCAGGCGGACGAGGCGCGGTCGCGG
CTGAAGCCGAGCACGAAGATGGAGGACCTCTCATCGGTCGACTTCGTGATCGAGGCGGTGCCGGAGATACCCAAG
CTCAAGTTCGAGATCTTCGGCAACCTGGCCAAGATGTGCGCCAAGCACGCGATCCTGGCGACCAACACGTCGTCC
ATCTCCATCACGCGCATCGCGGCGGCGACGACGTCGGATCCGACGGACACGTCGGCGTCGTCGCGCGTCGTGTCG
ACGCACTTTATGAACCCGGTGCCGGTGCAGAAGGGCGTCGAGATCATCAGCGGCCTCCAGACGAGCAAGGAGACG
CTGGACCGGGCGGTCGAGTTCTGCAAGAAGATGGGCAAGGTCGCCTCCGTGTCGACCGACTCCCCGGGCTTTCTG
GCCAACCGAATCCTGATGCCGTACATCAACGAGGCCGTCATCTGCCTGGAGACGGGGGTCGGGGATCGCGACTCG
ATCGACGCCATCATGAAGAACGGGACTAACGTGCCGATGGGCCCGCTCCAGCTTGCCGATTTCATCGGGCTGGAC
ACATGCCTGTCGATCATGAAGGTTCTGCACGAGGAGACGGGTGACTCCAAGTACAGACCGAGTGTCCTGCTCGGC
AAGATGGTCGATGCCGGCTGGCTGGGGAAGAAGAGCGGCAAGGGCTTCTACGACTACTGA
Gene >Hirsu2|10188
ATGGCGAGCTCACTTTTCCGGACGCGAGCCCCCGGGGCGGCGGCACAGCAGGCGCGCCTCTTCAGCTGCTCCGCG
CGACGGCACGCGGCAGACGTGGGCAGCCTCGGCGTCATCGGAGCCGGTCAGATGGTTCGTCCGCCCTGAGAGAGC
CCGTTCGTGGCGAAGGAGCATCCGGGCAAGGCAAATTGACGACGGAGAGATAGGGACTGGGCATTGCCTTGGTGG
CGGCTCAGAAGGCGCGCGTGCCCGTCACGCTCATCGACACGTCCGACGCGGCGCTGAAGAAGGGCCTGGCGTTTG
CCGGTAGATGCAGCGACCCCGAGCACAAGCTCCCCTCATGTTGGCGAAACTGACGCAGAGCGGCAGACAAGCTGC
TGGCCAAGGACGTGTCCAAGTCGAGGATTACGCAGGAGCAGGCGGACGAGGCGCGGTCGCGGCTGAAGCCGAGCA
CGAAGATGGAGGACCTCTCATCGGTCGACTTCGTGATCGAGGCGGTGCCGGAGATACCCAAGCTCAAGTTCGAGA
TCTTCGGCAACCTGGCCAAGATGTGCGCCAAGCACGCGATCCTGGCGACCAACACGTCGTCCATCTCCATCACGC
GCATCGCGGCGGCGACGACGTCGGATCCGACGGACACGTCGGCGTCGTCGCGCGTCGTGTCGACGCACTTTATGA
ACCCGGTGCCGGTGCAGAAGGGCGTCGAGATCATCAGCGGCCTCCAGACGAGCAAGGAGACGCTGGACCGGGCGG
TCGAGTTCTGCAAGAAGATGGGCAAGGTCGCCTCCGTGTCGACCGACTCCCCGGGCTTTCTGGCCAACCGAATCC
TGATGCCGTACATCAACGAGGCCGTCATCTGCCTGGAGACGGGGGTCGGGGATCGCGACTCGATCGACGCCATCA
TGAAGAACGGGACTAACGTGCCGATGGGCCCGCTCCAGCTTGCCGATTTCATCGGGCTGGACACATGCCTGTCGA
TCATGAAGGTTCTGCACGAGGAGACGGGTGACTCCAAGTACAGACCGAGTGTCCTGCTCGGCAAGATGGTCGATG
CCGGCTGGCTGGGGAAGAAGAGCGGCAAGGGCTTCTACGACTACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail