Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10186
Gene name
LocationContig_80:2038..3978
Strand-
Gene length (bp)1940
Transcript length (bp)1572
Coding sequence length (bp)1572
Protein length (aa) 524

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00505 HMG_box HMG (high mobility group) box 2.8E-16 117 183
PF09011 HMG_box_2 HMG-box domain 3.3E-12 115 176
PF00536 SAM_1 SAM domain (Sterile alpha motif) 2.2E-10 11 58
PF07647 SAM_2 SAM domain (Sterile alpha motif) 4.8E-07 12 59

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5ZKF4|HM20A_CHICK High mobility group protein 20A OS=Gallus gallus GN=HMG20A PE=2 SV=1 71 197 4.0E-13
sp|Q9DC33|HM20A_MOUSE High mobility group protein 20A OS=Mus musculus GN=Hmg20a PE=1 SV=1 100 197 7.0E-13
sp|Q9NP66|HM20A_HUMAN High mobility group protein 20A OS=Homo sapiens GN=HMG20A PE=1 SV=1 100 197 1.0E-12
sp|Q7S045|NHP6_NEUCR Non-histone chromosomal protein 6 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nhp-1 PE=3 SV=1 107 182 1.0E-11
sp|P11633|NHP6B_YEAST Non-histone chromosomal protein 6B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NHP6B PE=1 SV=3 103 185 2.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5ZKF4|HM20A_CHICK High mobility group protein 20A OS=Gallus gallus GN=HMG20A PE=2 SV=1 71 197 4.0E-13
sp|Q9DC33|HM20A_MOUSE High mobility group protein 20A OS=Mus musculus GN=Hmg20a PE=1 SV=1 100 197 7.0E-13
sp|Q9NP66|HM20A_HUMAN High mobility group protein 20A OS=Homo sapiens GN=HMG20A PE=1 SV=1 100 197 1.0E-12
sp|Q7S045|NHP6_NEUCR Non-histone chromosomal protein 6 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nhp-1 PE=3 SV=1 107 182 1.0E-11
sp|P11633|NHP6B_YEAST Non-histone chromosomal protein 6B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NHP6B PE=1 SV=3 103 185 2.0E-11
sp|P11632|NHP6A_YEAST Non-histone chromosomal protein 6A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NHP6A PE=1 SV=1 113 185 3.0E-11
sp|Q5B995|NHP6_EMENI Non-histone chromosomal protein 6 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nhp6 PE=3 SV=1 96 183 3.0E-11
sp|Q4IQX3|NHP6_GIBZE Non-histone chromosomal protein 6 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=NHP6 PE=3 SV=1 108 176 6.0E-11
sp|O04235|SSRP1_VICFA FACT complex subunit SSRP1 OS=Vicia faba GN=SSRP1 PE=2 SV=1 113 183 7.0E-11
sp|Q6DIJ5|HM20A_XENTR High mobility group protein 20A OS=Xenopus tropicalis GN=hmg20a PE=2 SV=1 104 205 1.0E-10
sp|Q4WY33|NHP6_ASPFU Non-histone chromosomal protein 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nhp6 PE=3 SV=1 111 176 3.0E-10
sp|Q6AZF8|HM20A_XENLA High mobility group protein 20A OS=Xenopus laevis GN=hmg20a PE=2 SV=1 104 192 3.0E-10
sp|O15347|HMGB3_HUMAN High mobility group protein B3 OS=Homo sapiens GN=HMGB3 PE=1 SV=4 113 188 4.0E-10
sp|Q32L31|HMGB3_BOVIN High mobility group protein B3 OS=Bos taurus GN=HMGB3 PE=2 SV=2 113 188 4.0E-10
sp|P87057|NHP6_SCHPO Non-histone chromosomal protein 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nhp6 PE=3 SV=1 111 182 5.0E-10
sp|P40618|HMGB3_CHICK High mobility group protein B3 OS=Gallus gallus GN=HMGB3 PE=2 SV=3 113 188 6.0E-10
sp|O54879|HMGB3_MOUSE High mobility group protein B3 OS=Mus musculus GN=Hmgb3 PE=1 SV=3 113 188 6.0E-10
sp|Q75B82|NHP6_ASHGO Non-histone chromosomal protein 6 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=NHP6 PE=3 SV=1 113 185 7.0E-10
sp|Q6CVH3|NHP6_KLULA Non-histone chromosomal protein 6 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=NHP6 PE=3 SV=1 102 185 1.0E-09
sp|Q9UVL1|NHP6_CANAL Non-histone chromosomal protein 6 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NHP6 PE=3 SV=1 113 184 4.0E-09
sp|Q4H2R2|SSRP1_CIOIN FACT complex subunit SSRP1 OS=Ciona intestinalis GN=SSRP1 PE=2 SV=1 100 183 6.0E-09
sp|Q9Z104|HM20B_MOUSE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1-related OS=Mus musculus GN=Hmg20b PE=1 SV=1 86 202 1.0E-08
sp|Q6BRB4|NHP6_DEBHA Non-histone chromosomal protein 6 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=NHP6 PE=3 SV=1 113 184 1.0E-08
sp|Q9SUP7|HMGB6_ARATH High mobility group B protein 6 OS=Arabidopsis thaliana GN=HMGB6 PE=2 SV=1 117 187 3.0E-08
sp|P40620|HMGL_VICFA HMG1/2-like protein OS=Vicia faba PE=2 SV=1 113 187 5.0E-08
sp|P0CO24|NHP6_CRYNJ Non-histone chromosomal protein 6 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=NHP6 PE=3 SV=1 107 174 6.0E-08
sp|P0CO25|NHP6_CRYNB Non-histone chromosomal protein 6 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=NHP6 PE=3 SV=1 107 174 6.0E-08
sp|P07746|HMGT_ONCMY High mobility group-T protein OS=Oncorhynchus mykiss PE=2 SV=2 78 183 8.0E-08
sp|Q6CC79|NHP6_YARLI Non-histone chromosomal protein 6 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=NHP6 PE=3 SV=1 113 183 1.0E-07
sp|Q4PBZ9|NHP6_USTMA Non-histone chromosomal protein 6 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=NHP6 PE=3 SV=2 111 169 1.0E-07
sp|P26583|HMGB2_HUMAN High mobility group protein B2 OS=Homo sapiens GN=HMGB2 PE=1 SV=2 115 183 2.0E-07
sp|P40673|HMGB2_BOVIN High mobility group protein B2 OS=Bos taurus GN=HMGB2 PE=1 SV=3 115 183 2.0E-07
sp|P52925|HMGB2_RAT High mobility group protein B2 OS=Rattus norvegicus GN=Hmgb2 PE=2 SV=2 115 183 2.0E-07
sp|Q9T012|HMG13_ARATH High mobility group B protein 13 OS=Arabidopsis thaliana GN=HMGB13 PE=2 SV=1 117 187 2.0E-07
sp|Q9YH06|HMGB1_CHICK High mobility group protein B1 OS=Gallus gallus GN=HMGB1 PE=1 SV=1 78 183 2.0E-07
sp|P17741|HMGB2_PIG High mobility group protein B2 OS=Sus scrofa GN=HMGB2 PE=1 SV=2 115 183 2.0E-07
sp|Q32L68|HM20B_BOVIN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1-related OS=Bos taurus GN=HMG20B PE=2 SV=1 115 189 2.0E-07
sp|P26584|HMGB2_CHICK High mobility group protein B2 OS=Gallus gallus GN=HMGB2 PE=2 SV=2 113 183 3.0E-07
sp|O15405|TOX3_HUMAN TOX high mobility group box family member 3 OS=Homo sapiens GN=TOX3 PE=1 SV=2 75 268 3.0E-07
sp|Q80W03|TOX3_MOUSE TOX high mobility group box family member 3 OS=Mus musculus GN=Tox3 PE=2 SV=1 32 183 4.0E-07
sp|Q9P0W2|HM20B_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1-related OS=Homo sapiens GN=HMG20B PE=1 SV=1 115 192 4.0E-07
sp|Q24537|HMG2_DROME High mobility group protein DSP1 OS=Drosophila melanogaster GN=Dsp1 PE=2 SV=1 80 183 4.0E-07
sp|Q9W602|SSRP1_XENLA FACT complex subunit SSRP1 OS=Xenopus laevis GN=ssrp1 PE=1 SV=1 101 182 5.0E-07
sp|Q08943|SSRP1_MOUSE FACT complex subunit SSRP1 OS=Mus musculus GN=Ssrp1 PE=1 SV=2 87 183 5.0E-07
sp|Q04678|SSRP1_CHICK FACT complex subunit SSRP1 OS=Gallus gallus GN=SSRP1 PE=2 SV=2 113 182 8.0E-07
sp|P30681|HMGB2_MOUSE High mobility group protein B2 OS=Mus musculus GN=Hmgb2 PE=1 SV=3 115 183 1.0E-06
sp|Q04931|SSRP1_RAT FACT complex subunit SSRP1 OS=Rattus norvegicus GN=Ssrp1 PE=1 SV=2 113 183 1.0E-06
sp|Q8BU11|TOX4_MOUSE TOX high mobility group box family member 4 OS=Mus musculus GN=Tox4 PE=1 SV=3 83 196 1.0E-06
sp|Q99PM1|TOX4_RAT TOX high mobility group box family member 4 OS=Rattus norvegicus GN=Tox4 PE=1 SV=1 83 196 1.0E-06
sp|Q08945|SSRP1_HUMAN FACT complex subunit SSRP1 OS=Homo sapiens GN=SSRP1 PE=1 SV=1 104 183 2.0E-06
sp|Q5R6A9|TOX4_PONAB TOX high mobility group box family member 4 OS=Pongo abelii GN=TOX4 PE=2 SV=2 113 196 2.0E-06
sp|B7SBD2|TOX3_RAT TOX high mobility group box family member 3 OS=Rattus norvegicus GN=Tox3 PE=1 SV=1 75 183 2.0E-06
sp|O94842|TOX4_HUMAN TOX high mobility group box family member 4 OS=Homo sapiens GN=TOX4 PE=1 SV=1 113 196 2.0E-06
sp|P27347|MNB1B_MAIZE DNA-binding protein MNB1B OS=Zea mays GN=MNB1B PE=1 SV=1 113 184 2.0E-06
sp|P40623|HMG1B_CHITE Mobility group protein 1B OS=Chironomus tentans GN=HMG1B PE=3 SV=1 115 185 2.0E-06
sp|Q0P5K4|TOX4_BOVIN TOX high mobility group box family member 4 OS=Bos taurus GN=TOX4 PE=2 SV=1 113 189 3.0E-06
sp|P40619|HMGL_IPONI HMG1/2-like protein OS=Ipomoea nil PE=2 SV=1 113 184 4.0E-06
sp|O49596|HMGB2_ARATH High mobility group B protein 2 OS=Arabidopsis thaliana GN=HMGB2 PE=1 SV=1 113 187 4.0E-06
sp|P40621|HMGL_WHEAT HMG1/2-like protein OS=Triticum aestivum PE=2 SV=1 88 184 6.0E-06
sp|O49595|HMGB1_ARATH High mobility group B protein 1 OS=Arabidopsis thaliana GN=HMGB1 PE=1 SV=1 108 187 7.0E-06
sp|Q6IRR0|TOX4B_XENLA TOX high mobility group box family member 4-B OS=Xenopus laevis GN=tox4-b PE=2 SV=1 113 183 7.0E-06
sp|P07156|HMGB1_CRIGR High mobility group protein B1 (Fragment) OS=Cricetulus griseus GN=HMGB1 PE=1 SV=1 78 183 7.0E-06
sp|P09429|HMGB1_HUMAN High mobility group protein B1 OS=Homo sapiens GN=HMGB1 PE=1 SV=3 78 183 8.0E-06
sp|A4QNP0|TOX4_XENTR TOX high mobility group box family member 4 OS=Xenopus tropicalis GN=tox4 PE=2 SV=1 113 183 8.0E-06
sp|Q05153|SSRP1_ARATH FACT complex subunit SSRP1 OS=Arabidopsis thaliana GN=SSRP1 PE=1 SV=2 119 183 8.0E-06
sp|P10103|HMGB1_BOVIN High mobility group protein B1 OS=Bos taurus GN=HMGB1 PE=1 SV=3 78 183 8.0E-06
sp|B0CM99|HMGB1_CALJA High mobility group protein B1 OS=Callithrix jacchus GN=HMGB1 PE=3 SV=1 78 183 8.0E-06
sp|B1MTB0|HMGB1_CALMO High mobility group protein B1 OS=Callicebus moloch GN=HMGB1 PE=3 SV=1 78 183 8.0E-06
sp|Q6YKA4|HMGB1_CANLF High mobility group protein B1 OS=Canis lupus familiaris GN=HMGB1 PE=2 SV=3 78 183 8.0E-06
sp|Q08IE6|HMGB1_HORSE High mobility group protein B1 OS=Equus caballus GN=HMGB1 PE=2 SV=3 78 183 8.0E-06
sp|Q4R844|HMGB1_MACFA High mobility group protein B1 OS=Macaca fascicularis GN=HMGB1 PE=2 SV=3 78 183 8.0E-06
sp|P63158|HMGB1_MOUSE High mobility group protein B1 OS=Mus musculus GN=Hmgb1 PE=1 SV=2 78 183 8.0E-06
sp|A9RA84|HMGB1_PAPAN High mobility group protein B1 OS=Papio anubis GN=HMGB1 PE=3 SV=1 78 183 8.0E-06
sp|P63159|HMGB1_RAT High mobility group protein B1 OS=Rattus norvegicus GN=Hmgb1 PE=1 SV=2 78 183 8.0E-06
sp|Q6DJL0|TOX4A_XENLA TOX high mobility group box family member 4-A OS=Xenopus laevis GN=tox4-a PE=2 SV=1 113 183 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3038 0.9162 0.0954 0.0153 0.0389 0.0019 0.0247 0.0274 0.0137 0.0188

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
HMG

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1127
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3549
Ophiocordyceps australis map64 (Brazil) OphauB2|1703
Ophiocordyceps camponoti-floridani Ophcf2|07148
Ophiocordyceps camponoti-rufipedis Ophun1|6040
Ophiocordyceps kimflemingae Ophio5|2278
Ophiocordyceps subramaniannii Hirsu2|10186 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10186
MTRELESIFADLGLSQYLDAFVDQGFDAWDTILDIQESDLDALGVKLGHRRKLQRRIANARGIAPSVSLACTAKS
ASDESKPDNLRRESSRSDGAPDANGVAKRKYRRHPKPDENAPERPPSAYVLFSNKMREDLKSHNLTFTEIAKLVG
ENWQSLPPAEREPYESQANAAKEKYHCSLNEYKKTPEFRKYTQYLQDFKEKQARQNKGHDVSKRLKLEPPRLRHG
GSTSSGATSSGTTSSGSGGSDDRLPGNEAASTRHERLRSPANVAEAQHSPTSPTSPSPEHGVDDGGLSPRGARFD
GSSPPEQGHGHSRHPSSWTRRHRTASTHQHQHLPSLSDMLDNRKRAVDSPMMDGNAFVPSIAASGQSRLVGDGPP
VLPPARVPLLHHEPSSNGTTVSRSSTGSLGRVPGEGPLPIHALLADRTMTGSAELEKRPVPSLKAAVSPSSRRNP
AHELVVPGPRGYGFQSETSAFQNMKVEQAGDGDVLMLSVDAAPPAPGASGKGGFDGMSALLRAGEIVGRRGPP*
Coding >Hirsu2|10186
ATGACTCGAGAACTCGAGAGCATCTTCGCAGACTTGGGTCTGTCCCAATATCTCGATGCCTTCGTCGACCAGGGC
TTCGACGCATGGGACACCATCCTCGACATCCAGGAGTCCGATCTCGATGCATTGGGTGTGAAGCTCGGACACCGC
AGGAAGCTGCAAAGGCGTATTGCCAACGCCAGGGGCATCGCTCCGAGCGTATCGCTGGCCTGTACCGCAAAGTCC
GCCTCGGACGAGTCCAAGCCCGACAATCTGCGGCGCGAAAGCAGCCGCAGTGATGGTGCCCCGGACGCCAACGGC
GTCGCAAAGCGCAAGTATCGCCGGCACCCCAAGCCGGATGAGAACGCCCCTGAAAGACCGCCGTCGGCCTACGTG
CTCTTCTCCAACAAGATGAGAGAAGACCTGAAATCCCACAACCTCACCTTCACCGAAATCGCCAAACTGGTGGGT
GAGAATTGGCAGAGCCTGCCGCCGGCAGAGAGGGAACCGTACGAAAGCCAAGCGAATGCGGCCAAGGAGAAGTAC
CACTGCAGCCTGAACGAGTACAAGAAGACACCCGAATTCCGCAAGTACACCCAGTATCTGCAAGACTTCAAGGAG
AAGCAGGCCCGGCAGAACAAAGGTCACGATGTGTCGAAGCGGCTCAAGCTGGAACCGCCGAGGCTGCGCCACGGC
GGCAGCACAAGCAGCGGGGCGACGTCGAGCGGGACGACGTCGAGCGGCAGCGGCGGCAGCGACGACAGGTTGCCG
GGAAACGAGGCAGCATCGACGCGACATGAGAGATTGAGGTCGCCAGCGAACGTGGCCGAAGCCCAGCACTCGCCC
ACTTCGCCGACATCACCGTCGCCGGAACACGGCGTCGACGATGGCGGACTGTCGCCTAGGGGCGCCCGTTTCGAC
GGCAGCAGCCCGCCGGAGCAGGGGCACGGACACTCTCGCCACCCGTCGTCCTGGACACGCAGACACCGGACGGCC
TCGACGCACCAGCACCAGCATCTGCCGTCGCTGTCCGACATGCTGGACAACCGCAAAAGGGCCGTGGACTCGCCC
ATGATGGACGGCAATGCGTTCGTGCCGAGCATAGCGGCGTCGGGCCAGTCGCGGCTGGTGGGCGACGGGCCGCCC
GTTCTGCCTCCGGCCCGCGTGCCGTTATTGCACCACGAGCCGTCATCGAACGGCACGACGGTATCTCGGAGCTCG
ACGGGAAGCCTGGGCAGGGTGCCGGGCGAGGGGCCGCTGCCCATCCACGCGCTCCTGGCGGATCGGACGATGACG
GGATCTGCCGAGCTCGAGAAGCGACCGGTTCCGAGCCTCAAAGCTGCCGTAAGTCCCAGCAGCCGACGAAATCCC
GCGCATGAGCTTGTTGTACCTGGACCGAGGGGCTACGGCTTCCAATCCGAGACATCGGCCTTCCAGAACATGAAA
GTGGAGCAGGCCGGGGACGGCGATGTGTTGATGTTGTCAGTCGATGCCGCACCCCCCGCCCCGGGAGCGAGTGGA
AAGGGCGGATTCGACGGGATGAGCGCCCTGCTACGAGCGGGCGAGATTGTGGGGCGACGAGGCCCCCCGTGA
Transcript >Hirsu2|10186
ATGACTCGAGAACTCGAGAGCATCTTCGCAGACTTGGGTCTGTCCCAATATCTCGATGCCTTCGTCGACCAGGGC
TTCGACGCATGGGACACCATCCTCGACATCCAGGAGTCCGATCTCGATGCATTGGGTGTGAAGCTCGGACACCGC
AGGAAGCTGCAAAGGCGTATTGCCAACGCCAGGGGCATCGCTCCGAGCGTATCGCTGGCCTGTACCGCAAAGTCC
GCCTCGGACGAGTCCAAGCCCGACAATCTGCGGCGCGAAAGCAGCCGCAGTGATGGTGCCCCGGACGCCAACGGC
GTCGCAAAGCGCAAGTATCGCCGGCACCCCAAGCCGGATGAGAACGCCCCTGAAAGACCGCCGTCGGCCTACGTG
CTCTTCTCCAACAAGATGAGAGAAGACCTGAAATCCCACAACCTCACCTTCACCGAAATCGCCAAACTGGTGGGT
GAGAATTGGCAGAGCCTGCCGCCGGCAGAGAGGGAACCGTACGAAAGCCAAGCGAATGCGGCCAAGGAGAAGTAC
CACTGCAGCCTGAACGAGTACAAGAAGACACCCGAATTCCGCAAGTACACCCAGTATCTGCAAGACTTCAAGGAG
AAGCAGGCCCGGCAGAACAAAGGTCACGATGTGTCGAAGCGGCTCAAGCTGGAACCGCCGAGGCTGCGCCACGGC
GGCAGCACAAGCAGCGGGGCGACGTCGAGCGGGACGACGTCGAGCGGCAGCGGCGGCAGCGACGACAGGTTGCCG
GGAAACGAGGCAGCATCGACGCGACATGAGAGATTGAGGTCGCCAGCGAACGTGGCCGAAGCCCAGCACTCGCCC
ACTTCGCCGACATCACCGTCGCCGGAACACGGCGTCGACGATGGCGGACTGTCGCCTAGGGGCGCCCGTTTCGAC
GGCAGCAGCCCGCCGGAGCAGGGGCACGGACACTCTCGCCACCCGTCGTCCTGGACACGCAGACACCGGACGGCC
TCGACGCACCAGCACCAGCATCTGCCGTCGCTGTCCGACATGCTGGACAACCGCAAAAGGGCCGTGGACTCGCCC
ATGATGGACGGCAATGCGTTCGTGCCGAGCATAGCGGCGTCGGGCCAGTCGCGGCTGGTGGGCGACGGGCCGCCC
GTTCTGCCTCCGGCCCGCGTGCCGTTATTGCACCACGAGCCGTCATCGAACGGCACGACGGTATCTCGGAGCTCG
ACGGGAAGCCTGGGCAGGGTGCCGGGCGAGGGGCCGCTGCCCATCCACGCGCTCCTGGCGGATCGGACGATGACG
GGATCTGCCGAGCTCGAGAAGCGACCGGTTCCGAGCCTCAAAGCTGCCGTAAGTCCCAGCAGCCGACGAAATCCC
GCGCATGAGCTTGTTGTACCTGGACCGAGGGGCTACGGCTTCCAATCCGAGACATCGGCCTTCCAGAACATGAAA
GTGGAGCAGGCCGGGGACGGCGATGTGTTGATGTTGTCAGTCGATGCCGCACCCCCCGCCCCGGGAGCGAGTGGA
AAGGGCGGATTCGACGGGATGAGCGCCCTGCTACGAGCGGGCGAGATTGTGGGGCGACGAGGCCCCCCGTGA
Gene >Hirsu2|10186
ATGACTCGAGAACTCGAGAGCATCTTCGCAGACTTGGGTCTGTCCCAATATCTCGATGCCTTCGTCGACCAGGGC
TTCGACGCATGGGACACCATCCTCGACATCCAGGAGTCCGATCTGTGAGCCTGCCGTATGCCCACCGCTGCCGGC
CTTCTTTGCTGACCCGCGTGCGAAGCGATGCATTGGGTGTGAAGCTCGGACACCGCAGGGTAAGTTCTGGACGGC
CAAGCGGTCCACGCGAGGCACAAGGCTGACGCGTCATTCGCTCCCCTCGGCCTGTAGAAGCTGCAAAGGCGTATT
GCCAACGCCAGGGGCATCGCTCCGAGCGTATCGCTGGCCTGTACCGCAAAGTCCGCCTCGGACGAGTCCAAGCCC
GACAATCTGCGGCGCGAAAGCAGCCGCAGTGATGGTGCCCCGGACGCCAACGGCGTCGCAAAGCGCAAGTATCGC
CGGCACCCCAAGGTACGAGGTCTCGCCCTTGTCCGGGGCCGTGGGGGGCAAGCCGTCTGACACCGTCGACAGCCG
GATGAGAACGCCCCTGAAAGACCGCCGTCGGCCTACGTGCTCTTCTCCAACAGTCAGTACCTGCCGTGGTCGCTT
CGGCTGGAAACGTGCTCACCGTCGCCGCAGAGATGAGAGAAGACCTGAAATCCCACAACCTCACCTTCACCGAAA
TCGCCAAACTGGTGGGTGAGAATTGGCAGAGCCTGCCGCCGGCAGAGAGGGAACCGTACGAAAGCCAAGCGAATG
CGGCCAAGGAGAAGTACCACTGCAGCCTGAACGAGTACAAGAAGACACCCGAATTCCGCAAGTACACCCAGTATC
TGCAAGACTTCAAGGAGAAGCAGGCCCGGCAGAACAAAGGTTGGTTGGCCAAGGCATCGATGGTGGCTGCCTCTG
GTCACTGGTCTCACATGCCTCGCACGATAGGTCACGATGTGTCGAAGCGGCTCAAGCTGGAACCGCCGAGGCTGC
GCCACGGCGGCAGCACAAGCAGCGGGGCGACGTCGAGCGGGACGACGTCGAGCGGCAGCGGCGGCAGCGACGACA
GGTTGCCGGGAAACGAGGCAGCATCGACGCGACATGAGAGATTGAGGTCGCCAGCGAACGTGGCCGAAGCCCAGC
ACTCGCCCACTTCGCCGACATCACCGTCGCCGGAACACGGCGTCGACGATGGCGGACTGTCGCCTAGGGGCGCCC
GTTTCGACGGCAGCAGCCCGCCGGAGCAGGGGCACGGACACTCTCGCCACCCGTCGTCCTGGACACGCAGACACC
GGACGGCCTCGACGCACCAGCACCAGCATCTGCCGTCGCTGTCCGACATGCTGGACAACCGCAAAAGGGCCGTGG
ACTCGCCCATGATGGACGGCAATGCGTTCGTGCCGAGCATAGCGGCGTCGGGCCAGTCGCGGCTGGTGGGCGACG
GGCCGCCCGTTCTGCCTCCGGCCCGCGTGCCGTTATTGCACCACGAGCCGTCATCGAACGGCACGACGGTATCTC
GGAGCTCGACGGGAAGCCTGGGCAGGGTGCCGGGCGAGGGGCCGCTGCCCATCCACGCGCTCCTGGCGGATCGGA
CGATGACGGGATCTGCCGAGCTCGAGAAGCGACCGGTTCCGAGCCTCAAAGCTGCCGTAAGTCCCAGCAGCCGAC
GAAATCCCGCGCATGAGCTTGTTGTACCTGGACCGAGGGGCTACGGTACCGATCCCTACCTCTCGAACAATGCCA
CTCAGGCGCACAGCTAACGTGGCGCGTAAGGCTTCCAATCCGAGACATCGGCCTTCCAGAACATGAAAGTGGAGC
AGGCCGGGGACGGCGATGTGTTGATGTTGTCAGTCGATGCCGCACCCCCCGCCCCGGGAGCGAGTGGAAAGGGCG
GATTCGACGGGATGAGCGCCCTGCTACGAGCGGGCGAGATTGTGGGGCGACGAGGCCCCCCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail