Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10183
Gene name
LocationContig_8:80762..81947
Strand-
Gene length (bp)1185
Transcript length (bp)945
Coding sequence length (bp)945
Protein length (aa) 315

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00096 zf-C2H2 Zinc finger, C2H2 type 6.3E-03 42 65

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O43670|ZN207_HUMAN BUB3-interacting and GLEBS motif-containing protein ZNF207 OS=Homo sapiens GN=ZNF207 PE=1 SV=1 1 116 2.0E-29
sp|Q7ZXV8|ZN207_XENLA BUB3-interacting and GLEBS motif-containing protein ZNF207 OS=Xenopus laevis GN=znf207 PE=1 SV=1 17 116 6.0E-29
sp|Q9JMD0|ZN207_MOUSE BUB3-interacting and GLEBS motif-containing protein ZNF207 OS=Mus musculus GN=Znf207 PE=1 SV=1 1 116 1.0E-28
sp|Q9C5G0|SUF4_ARATH Protein SUPPRESSOR OF FRI 4 OS=Arabidopsis thaliana GN=SUF4 PE=1 SV=1 1 100 1.0E-28
sp|Q5R8K4|ZN207_PONAB BUB3-interacting and GLEBS motif-containing protein ZNF207 OS=Pongo abelii GN=ZNF207 PE=2 SV=1 1 116 3.0E-28

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
C2H2 zinc finger

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10183
MGKKRRGHPDVEDVLARPWCYYCERDFEDLKLLISHQKAKHFKCDRCGRRLNTAGGLSVHMNQVHKETLHQVENA
LNNRQGLDVEIFGMEGIPHDILEQHRNRIIQNFYQAQEDRRIATGNPLPGQATHNPKKKIKMETKEELLVRVREW
RAKKKAEREAVASGGDDGAAAANANVAPEQLSGQYQQPQQGFEQASYAGQAAHGQPPYGYHANSLPARPPGSVGA
PPGLPQRLTEGTDRNVAAGAQAAATGDDIDKMIRMAEAGVKSTQKAEDGGDGEKKSKKGRLVYDDAEVSPEEKMA
AMPRYAFHPDIAAA*
Coding >Hirsu2|10183
ATGGGGAAGAAGCGGCGCGGACACCCCGACGTCGAGGACGTCCTCGCTCGTCCGTGGTGCTACTACTGCGAGCGA
GACTTTGAGGACTTGAAGCTCCTCATCTCTCATCAGAAAGCAAAGCACTTCAAGTGCGACAGATGCGGCAGACGT
CTCAACACTGCAGGAGGTCTCTCCGTCCACATGAACCAAGTCCACAAAGAAACGCTCCACCAGGTCGAGAATGCG
CTCAATAATCGCCAGGGCCTCGACGTGGAGATTTTCGGCATGGAAGGTATCCCGCACGACATTCTCGAACAACAT
CGGAACCGCATCATCCAGAACTTCTACCAGGCGCAGGAGGACCGCCGAATCGCCACGGGAAACCCCCTCCCCGGC
CAAGCCACCCACAACCCCAAGAAGAAGATCAAGATGGAGACGAAAGAGGAGCTGCTGGTGAGGGTCAGGGAATGG
CGCGCCAAGAAGAAGGCCGAGAGAGAGGCGGTCGCTAGCGGAGGTGACGATGGTGCTGCCGCCGCGAACGCGAAC
GTCGCCCCAGAACAACTCAGCGGCCAATACCAGCAGCCACAGCAAGGGTTCGAGCAAGCAAGCTACGCGGGCCAG
GCTGCTCACGGCCAGCCTCCCTACGGATACCATGCCAACTCACTGCCGGCCCGGCCCCCCGGGAGCGTGGGAGCT
CCTCCCGGCCTGCCGCAACGGCTGACTGAAGGAACCGACAGGAACGTCGCGGCTGGGGCGCAGGCCGCCGCGACG
GGCGACGACATCGACAAGATGATTCGCATGGCCGAAGCGGGCGTCAAGTCGACGCAAAAGGCCGAGGACGGCGGG
GACGGGGAGAAGAAGTCGAAGAAGGGCAGGCTGGTGTACGACGACGCGGAAGTCAGCCCGGAGGAGAAGATGGCG
GCAATGCCGCGCTACGCATTCCACCCAGACATTGCGGCGGCCTGA
Transcript >Hirsu2|10183
ATGGGGAAGAAGCGGCGCGGACACCCCGACGTCGAGGACGTCCTCGCTCGTCCGTGGTGCTACTACTGCGAGCGA
GACTTTGAGGACTTGAAGCTCCTCATCTCTCATCAGAAAGCAAAGCACTTCAAGTGCGACAGATGCGGCAGACGT
CTCAACACTGCAGGAGGTCTCTCCGTCCACATGAACCAAGTCCACAAAGAAACGCTCCACCAGGTCGAGAATGCG
CTCAATAATCGCCAGGGCCTCGACGTGGAGATTTTCGGCATGGAAGGTATCCCGCACGACATTCTCGAACAACAT
CGGAACCGCATCATCCAGAACTTCTACCAGGCGCAGGAGGACCGCCGAATCGCCACGGGAAACCCCCTCCCCGGC
CAAGCCACCCACAACCCCAAGAAGAAGATCAAGATGGAGACGAAAGAGGAGCTGCTGGTGAGGGTCAGGGAATGG
CGCGCCAAGAAGAAGGCCGAGAGAGAGGCGGTCGCTAGCGGAGGTGACGATGGTGCTGCCGCCGCGAACGCGAAC
GTCGCCCCAGAACAACTCAGCGGCCAATACCAGCAGCCACAGCAAGGGTTCGAGCAAGCAAGCTACGCGGGCCAG
GCTGCTCACGGCCAGCCTCCCTACGGATACCATGCCAACTCACTGCCGGCCCGGCCCCCCGGGAGCGTGGGAGCT
CCTCCCGGCCTGCCGCAACGGCTGACTGAAGGAACCGACAGGAACGTCGCGGCTGGGGCGCAGGCCGCCGCGACG
GGCGACGACATCGACAAGATGATTCGCATGGCCGAAGCGGGCGTCAAGTCGACGCAAAAGGCCGAGGACGGCGGG
GACGGGGAGAAGAAGTCGAAGAAGGGCAGGCTGGTGTACGACGACGCGGAAGTCAGCCCGGAGGAGAAGATGGCG
GCAATGCCGCGCTACGCATTCCACCCAGACATTGCGGCGGCCTGA
Gene >Hirsu2|10183
ATGGGGAAGAAGCGGCGCGGACACCCCGACGTCGAGGACGTCCTCGCTCGTCCGTGGTGCTACTACTGTGCGGTG
CCGCGTCCAGCCGAGACGTGAGAGGCTCGTAATACTGATATGGATCACCTCAGGCGAGCGAGACTTTGAGGACTT
GAAGCTCCTCATCTCTCATCAGAAAGCAAAGCACTTCAAGTGCGACAGATGCGGCAGACGTCTCAACACTGCAGG
AGGTACGGCACGCAGCGCAACTGCCAATCTGCCCGAGCGCGAAATGATCATGGAGAGTGAGAGATGGAGTAGCTG
ATAGCCTCGGTGTGTGCACCCTTTAGGTCTCTCCGTCCACATGAACCAAGTCCACAAAGAAACGCTCCACCAGGT
CGAGAATGCGCTCAATAATCGCCAGGGCCTCGACGTGGAGATTTTCGGCATGGAAGGTATCCCGCACGACATTCT
CGAACAACATCGGAACCGCATCATCCAGAACTTCTACCAGGCGCAGGAGGACCGCCGAATCGCCACGGGAAACCC
CCTCCCCGGCCAAGCCACCCACAACCCCAAGAAGAAGATCAAGATGGAGACGAAAGAGGAGCTGCTGGTGAGGGT
CAGGGAATGGCGCGCCAAGAAGAAGGCCGAGAGAGAGGCGGTCGCTAGCGGAGGTGACGATGGTGCTGCCGCCGC
GAACGCGAACGTCGCCCCAGAACAACTCGTAAGGCTCTCCCCACTCCTCTTCCTTGTACGAGAGACCACGAGCAT
GTGCTTCCCGTCATTGCTAACTCCCCGATCCAGAGCGGCCAATACCAGCAGCCACAGCAAGGGTTCGAGCAAGCA
AGCTACGCGGGCCAGGCTGCTCACGGCCAGCCTCCCTACGGATACCATGCCAACTCACTGCCGGCCCGGCCCCCC
GGGAGCGTGGGAGCTCCTCCCGGCCTGCCGCAACGGCTGACTGAAGGAACCGACAGGAACGTCGCGGCTGGGGCG
CAGGCCGCCGCGACGGGCGACGACATCGACAAGATGATTCGCATGGCCGAAGCGGGCGTCAAGTCGACGCAAAAG
GCCGAGGACGGCGGGGACGGGGAGAAGAAGTCGAAGAAGGGCAGGCTGGTGTACGACGACGCGGAAGTCAGCCCG
GAGGAGAAGATGGCGGCAATGCCGCGCTACGCATTCCACCCAGACATTGCGGCGGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail