Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1018
Gene name
LocationContig_121:18272..23248
Strand+
Gene length (bp)4976
Transcript length (bp)4731
Coding sequence length (bp)4731
Protein length (aa) 1577

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00443 UCH Ubiquitin carboxyl-terminal hydrolase 1.4E-66 579 1393
PF13423 UCH_1 Ubiquitin carboxyl-terminal hydrolase 5.1E-05 579 762
PF13423 UCH_1 Ubiquitin carboxyl-terminal hydrolase 1.8E-05 1242 1374
PF06337 DUSP DUSP domain 8.3E-10 250 342

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P39538|UBP12_YEAST Ubiquitin carboxyl-terminal hydrolase 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBP12 PE=1 SV=1 571 938 2.0E-70
sp|O60079|UBP12_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubp12 PE=1 SV=1 568 852 1.0E-66
sp|Q9USM5|UBP1_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubp1 PE=3 SV=1 566 847 8.0E-62
sp|Q9R085|UBP15_RAT Ubiquitin carboxyl-terminal hydrolase 15 OS=Rattus norvegicus GN=Usp15 PE=1 SV=1 523 842 1.0E-59
sp|Q2HJE4|UBP15_BOVIN Ubiquitin carboxyl-terminal hydrolase 15 OS=Bos taurus GN=USP15 PE=2 SV=1 523 842 3.0E-59
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P39538|UBP12_YEAST Ubiquitin carboxyl-terminal hydrolase 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBP12 PE=1 SV=1 571 938 2.0E-70
sp|O60079|UBP12_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubp12 PE=1 SV=1 568 852 1.0E-66
sp|Q9USM5|UBP1_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubp1 PE=3 SV=1 566 847 8.0E-62
sp|Q9R085|UBP15_RAT Ubiquitin carboxyl-terminal hydrolase 15 OS=Rattus norvegicus GN=Usp15 PE=1 SV=1 523 842 1.0E-59
sp|Q2HJE4|UBP15_BOVIN Ubiquitin carboxyl-terminal hydrolase 15 OS=Bos taurus GN=USP15 PE=2 SV=1 523 842 3.0E-59
sp|B2GUZ1|UBP4_RAT Ubiquitin carboxyl-terminal hydrolase 4 OS=Rattus norvegicus GN=Usp4 PE=1 SV=1 577 855 6.0E-58
sp|P35123|UBP4_MOUSE Ubiquitin carboxyl-terminal hydrolase 4 OS=Mus musculus GN=Usp4 PE=1 SV=3 577 835 9.0E-58
sp|Q8R5H1|UBP15_MOUSE Ubiquitin carboxyl-terminal hydrolase 15 OS=Mus musculus GN=Usp15 PE=1 SV=1 551 842 1.0E-57
sp|A6QR55|UBP4_BOVIN Ubiquitin carboxyl-terminal hydrolase 4 OS=Bos taurus GN=USP4 PE=2 SV=1 577 937 2.0E-57
sp|Q9Y4E8|UBP15_HUMAN Ubiquitin carboxyl-terminal hydrolase 15 OS=Homo sapiens GN=USP15 PE=1 SV=3 551 842 3.0E-57
sp|Q13107|UBP4_HUMAN Ubiquitin carboxyl-terminal hydrolase 4 OS=Homo sapiens GN=USP4 PE=1 SV=3 577 828 2.0E-56
sp|F6Z5C0|UBP15_XENTR Ubiquitin carboxyl-terminal hydrolase 15 OS=Xenopus tropicalis GN=usp15 PE=2 SV=2 550 842 2.0E-56
sp|Q5RCD3|UBP4_PONAB Ubiquitin carboxyl-terminal hydrolase 4 OS=Pongo abelii GN=USP4 PE=2 SV=1 577 828 4.0E-56
sp|Q9MAQ3|UBP11_ARATH Putative ubiquitin carboxyl-terminal hydrolase 11 OS=Arabidopsis thaliana GN=UBP11 PE=3 SV=2 563 860 6.0E-56
sp|P51784|UBP11_HUMAN Ubiquitin carboxyl-terminal hydrolase 11 OS=Homo sapiens GN=USP11 PE=1 SV=3 577 843 7.0E-56
sp|Q93Y01|UBP9_ARATH Ubiquitin carboxyl-terminal hydrolase 9 OS=Arabidopsis thaliana GN=UBP9 PE=2 SV=1 573 860 3.0E-55
sp|Q9ZSB5|UBP10_ARATH Ubiquitin carboxyl-terminal hydrolase 10 OS=Arabidopsis thaliana GN=UBP10 PE=2 SV=2 532 853 4.0E-54
sp|Q9C585|UBP8_ARATH Ubiquitin carboxyl-terminal hydrolase 8 OS=Arabidopsis thaliana GN=UBP8 PE=2 SV=2 577 857 5.0E-53
sp|Q99K46|UBP11_MOUSE Ubiquitin carboxyl-terminal hydrolase 11 OS=Mus musculus GN=Usp11 PE=1 SV=4 577 828 7.0E-53
sp|O22207|UBP5_ARATH Ubiquitin carboxyl-terminal hydrolase 5 OS=Arabidopsis thaliana GN=UBP5 PE=1 SV=2 535 825 2.0E-52
sp|P35125|UBP6_HUMAN Ubiquitin carboxyl-terminal hydrolase 6 OS=Homo sapiens GN=USP6 PE=1 SV=2 512 818 1.0E-51
sp|Q8NFA0|UBP32_HUMAN Ubiquitin carboxyl-terminal hydrolase 32 OS=Homo sapiens GN=USP32 PE=1 SV=1 577 818 2.0E-51
sp|Q6J1Y9|UBP19_RAT Ubiquitin carboxyl-terminal hydrolase 19 OS=Rattus norvegicus GN=Usp19 PE=1 SV=1 577 852 2.0E-47
sp|O94966|UBP19_HUMAN Ubiquitin carboxyl-terminal hydrolase 19 OS=Homo sapiens GN=USP19 PE=1 SV=2 577 849 2.0E-47
sp|Q3UJD6|UBP19_MOUSE Ubiquitin carboxyl-terminal hydrolase 19 OS=Mus musculus GN=Usp19 PE=1 SV=1 577 852 5.0E-47
sp|B2GUZ1|UBP4_RAT Ubiquitin carboxyl-terminal hydrolase 4 OS=Rattus norvegicus GN=Usp4 PE=1 SV=1 1240 1396 2.0E-44
sp|P35123|UBP4_MOUSE Ubiquitin carboxyl-terminal hydrolase 4 OS=Mus musculus GN=Usp4 PE=1 SV=3 1232 1396 4.0E-44
sp|P39538|UBP12_YEAST Ubiquitin carboxyl-terminal hydrolase 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBP12 PE=1 SV=1 1185 1412 8.0E-44
sp|Q13107|UBP4_HUMAN Ubiquitin carboxyl-terminal hydrolase 4 OS=Homo sapiens GN=USP4 PE=1 SV=3 1178 1396 2.0E-43
sp|A6QR55|UBP4_BOVIN Ubiquitin carboxyl-terminal hydrolase 4 OS=Bos taurus GN=USP4 PE=2 SV=1 1178 1396 4.0E-43
sp|Q5RCD3|UBP4_PONAB Ubiquitin carboxyl-terminal hydrolase 4 OS=Pongo abelii GN=USP4 PE=2 SV=1 1240 1396 7.0E-42
sp|O60079|UBP12_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubp12 PE=1 SV=1 1192 1398 8.0E-42
sp|Q9C585|UBP8_ARATH Ubiquitin carboxyl-terminal hydrolase 8 OS=Arabidopsis thaliana GN=UBP8 PE=2 SV=2 1242 1395 5.0E-41
sp|Q9MAQ3|UBP11_ARATH Putative ubiquitin carboxyl-terminal hydrolase 11 OS=Arabidopsis thaliana GN=UBP11 PE=3 SV=2 1192 1398 6.0E-41
sp|Q9ZSB5|UBP10_ARATH Ubiquitin carboxyl-terminal hydrolase 10 OS=Arabidopsis thaliana GN=UBP10 PE=2 SV=2 1192 1398 2.0E-40
sp|O22207|UBP5_ARATH Ubiquitin carboxyl-terminal hydrolase 5 OS=Arabidopsis thaliana GN=UBP5 PE=1 SV=2 1241 1397 4.0E-40
sp|Q93Y01|UBP9_ARATH Ubiquitin carboxyl-terminal hydrolase 9 OS=Arabidopsis thaliana GN=UBP9 PE=2 SV=1 1192 1398 2.0E-39
sp|F6Z5C0|UBP15_XENTR Ubiquitin carboxyl-terminal hydrolase 15 OS=Xenopus tropicalis GN=usp15 PE=2 SV=2 1242 1398 4.0E-38
sp|Q9Y4E8|UBP15_HUMAN Ubiquitin carboxyl-terminal hydrolase 15 OS=Homo sapiens GN=USP15 PE=1 SV=3 1192 1398 7.0E-38
sp|Q2HJE4|UBP15_BOVIN Ubiquitin carboxyl-terminal hydrolase 15 OS=Bos taurus GN=USP15 PE=2 SV=1 1192 1398 8.0E-38
sp|Q8R5H1|UBP15_MOUSE Ubiquitin carboxyl-terminal hydrolase 15 OS=Mus musculus GN=Usp15 PE=1 SV=1 1192 1398 8.0E-38
sp|Q9R085|UBP15_RAT Ubiquitin carboxyl-terminal hydrolase 15 OS=Rattus norvegicus GN=Usp15 PE=1 SV=1 1192 1398 2.0E-37
sp|Q6J1Y9|UBP19_RAT Ubiquitin carboxyl-terminal hydrolase 19 OS=Rattus norvegicus GN=Usp19 PE=1 SV=1 1247 1398 2.0E-37
sp|Q3UJD6|UBP19_MOUSE Ubiquitin carboxyl-terminal hydrolase 19 OS=Mus musculus GN=Usp19 PE=1 SV=1 1247 1398 3.0E-37
sp|O94966|UBP19_HUMAN Ubiquitin carboxyl-terminal hydrolase 19 OS=Homo sapiens GN=USP19 PE=1 SV=2 1247 1398 4.0E-37
sp|P51784|UBP11_HUMAN Ubiquitin carboxyl-terminal hydrolase 11 OS=Homo sapiens GN=USP11 PE=1 SV=3 1247 1396 8.0E-37
sp|P40818|UBP8_HUMAN Ubiquitin carboxyl-terminal hydrolase 8 OS=Homo sapiens GN=USP8 PE=1 SV=1 579 764 9.0E-36
sp|Q70CQ4|UBP31_HUMAN Ubiquitin carboxyl-terminal hydrolase 31 OS=Homo sapiens GN=USP31 PE=2 SV=2 1178 1400 1.0E-35
sp|Q99K46|UBP11_MOUSE Ubiquitin carboxyl-terminal hydrolase 11 OS=Mus musculus GN=Usp11 PE=1 SV=4 1192 1399 2.0E-35
sp|Q80U87|UBP8_MOUSE Ubiquitin carboxyl-terminal hydrolase 8 OS=Mus musculus GN=Usp8 PE=1 SV=2 579 764 1.0E-34
sp|Q01988|UBP11_CANLF Ubiquitin carboxyl-terminal hydrolase 11 (Fragment) OS=Canis lupus familiaris GN=USP11 PE=2 SV=1 1247 1396 2.0E-34
sp|O57429|UBP2_CHICK Ubiquitin carboxyl-terminal hydrolase 2 OS=Gallus gallus GN=USP2 PE=2 SV=1 577 765 5.0E-33
sp|Q8BUM9|UBP43_MOUSE Ubiquitin carboxyl-terminal hydrolase 43 OS=Mus musculus GN=Usp43 PE=1 SV=2 1182 1400 9.0E-33
sp|Q80U87|UBP8_MOUSE Ubiquitin carboxyl-terminal hydrolase 8 OS=Mus musculus GN=Usp8 PE=1 SV=2 1244 1409 2.0E-32
sp|P40818|UBP8_HUMAN Ubiquitin carboxyl-terminal hydrolase 8 OS=Homo sapiens GN=USP8 PE=1 SV=1 1244 1393 3.0E-32
sp|O75604|UBP2_HUMAN Ubiquitin carboxyl-terminal hydrolase 2 OS=Homo sapiens GN=USP2 PE=1 SV=2 551 764 1.0E-31
sp|Q70EL4|UBP43_HUMAN Ubiquitin carboxyl-terminal hydrolase 43 OS=Homo sapiens GN=USP43 PE=1 SV=2 1247 1400 1.0E-31
sp|P32571|UBP4_YEAST Ubiquitin carboxyl-terminal hydrolase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DOA4 PE=1 SV=2 578 768 2.0E-31
sp|A6ZY34|UBP4_YEAS7 Ubiquitin carboxyl-terminal hydrolase 4 OS=Saccharomyces cerevisiae (strain YJM789) GN=DOA4 PE=3 SV=1 578 768 2.0E-31
sp|B3LGK1|UBP4_YEAS1 Ubiquitin carboxyl-terminal hydrolase 4 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=DOA4 PE=3 SV=1 578 768 3.0E-31
sp|Q5U349|UBP2_RAT Ubiquitin carboxyl-terminal hydrolase 2 OS=Rattus norvegicus GN=Usp2 PE=1 SV=1 577 764 5.0E-31
sp|O88623|UBP2_MOUSE Ubiquitin carboxyl-terminal hydrolase 2 OS=Mus musculus GN=Usp2 PE=1 SV=2 577 764 7.0E-31
sp|Q2KHV7|UBP2_BOVIN Ubiquitin carboxyl-terminal hydrolase 2 OS=Bos taurus GN=USP2 PE=2 SV=1 550 764 1.0E-30
sp|Q9HFS7|UBP4_KLULA Ubiquitin carboxyl-terminal hydrolase 4 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DOA4 PE=3 SV=1 578 765 2.0E-30
sp|A7TGY3|UBP4_VANPO Ubiquitin carboxyl-terminal hydrolase 4 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DOA4 PE=3 SV=1 578 765 9.0E-30
sp|Q754R5|UBP4_ASHGO Ubiquitin carboxyl-terminal hydrolase 4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DOA4 PE=3 SV=2 578 765 4.0E-29
sp|Q9USM5|UBP1_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubp1 PE=3 SV=1 1192 1397 2.0E-28
sp|O57429|UBP2_CHICK Ubiquitin carboxyl-terminal hydrolase 2 OS=Gallus gallus GN=USP2 PE=2 SV=1 1247 1393 9.0E-28
sp|P39944|UBP5_YEAST Ubiquitin carboxyl-terminal hydrolase 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBP5 PE=1 SV=1 579 765 5.0E-27
sp|Q6FQF0|UBP4_CANGA Ubiquitin carboxyl-terminal hydrolase 4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DOA4 PE=3 SV=1 578 765 5.0E-27
sp|Q70CQ4|UBP31_HUMAN Ubiquitin carboxyl-terminal hydrolase 31 OS=Homo sapiens GN=USP31 PE=2 SV=2 577 843 2.0E-26
sp|Q9UK80|UBP21_HUMAN Ubiquitin carboxyl-terminal hydrolase 21 OS=Homo sapiens GN=USP21 PE=1 SV=1 576 765 2.0E-26
sp|A5PN09|UBP20_DANRE Ubiquitin carboxyl-terminal hydrolase 20 OS=Danio rerio GN=usp20 PE=3 SV=1 1247 1397 2.0E-26
sp|Q2KJ72|UBP21_BOVIN Ubiquitin carboxyl-terminal hydrolase 21 OS=Bos taurus GN=USP21 PE=2 SV=1 576 765 3.0E-26
sp|A7Z056|UBP20_BOVIN Ubiquitin carboxyl-terminal hydrolase 20 OS=Bos taurus GN=USP20 PE=2 SV=1 1247 1397 5.0E-26
sp|B2GUX4|UBP21_RAT Ubiquitin carboxyl-terminal hydrolase 21 OS=Rattus norvegicus GN=Usp21 PE=2 SV=1 576 765 8.0E-26
sp|Q9Y2K6|UBP20_HUMAN Ubiquitin carboxyl-terminal hydrolase 20 OS=Homo sapiens GN=USP20 PE=1 SV=2 1247 1397 1.0E-25
sp|Q5R5Z6|UBP20_PONAB Ubiquitin carboxyl-terminal hydrolase 20 OS=Pongo abelii GN=USP20 PE=2 SV=1 1247 1397 1.0E-25
sp|Q9QZL6|UBP21_MOUSE Ubiquitin carboxyl-terminal hydrolase 21 OS=Mus musculus GN=Usp21 PE=1 SV=1 576 765 2.0E-25
sp|O60139|UBP4_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubp4 PE=1 SV=2 579 764 2.0E-25
sp|Q8C6M1|UBP20_MOUSE Ubiquitin carboxyl-terminal hydrolase 20 OS=Mus musculus GN=Usp20 PE=1 SV=1 1247 1397 2.0E-25
sp|Q8R5K2|UBP33_MOUSE Ubiquitin carboxyl-terminal hydrolase 33 OS=Mus musculus GN=Usp33 PE=1 SV=2 1247 1397 3.0E-24
sp|Q5REG5|UBP33_PONAB Ubiquitin carboxyl-terminal hydrolase 33 OS=Pongo abelii GN=USP33 PE=2 SV=1 1247 1397 4.0E-24
sp|A0JM59|UBP20_XENTR Ubiquitin carboxyl-terminal hydrolase 20 OS=Xenopus tropicalis GN=usp20 PE=2 SV=1 1247 1397 4.0E-24
sp|Q6P8X6|UBP50_MOUSE Putative ubiquitin carboxyl-terminal hydrolase 50 OS=Mus musculus GN=Usp50 PE=2 SV=1 1248 1393 5.0E-24
sp|B1WBD7|UBP20_XENLA Ubiquitin carboxyl-terminal hydrolase 20 OS=Xenopus laevis GN=usp20 PE=2 SV=1 1247 1397 6.0E-24
sp|Q28CN3|UBP33_XENTR Ubiquitin carboxyl-terminal hydrolase 33 OS=Xenopus tropicalis GN=usp33 PE=2 SV=2 1247 1397 8.0E-24
sp|A6QNM7|UBP33_BOVIN Ubiquitin carboxyl-terminal hydrolase 33 OS=Bos taurus GN=USP33 PE=2 SV=1 1247 1397 9.0E-24
sp|Q8TEY7|UBP33_HUMAN Ubiquitin carboxyl-terminal hydrolase 33 OS=Homo sapiens GN=USP33 PE=1 SV=2 1247 1397 1.0E-23
sp|Q9Y6I4|UBP3_HUMAN Ubiquitin carboxyl-terminal hydrolase 3 OS=Homo sapiens GN=USP3 PE=1 SV=2 1204 1393 3.0E-23
sp|Q5U349|UBP2_RAT Ubiquitin carboxyl-terminal hydrolase 2 OS=Rattus norvegicus GN=Usp2 PE=1 SV=1 1247 1393 1.0E-22
sp|O88623|UBP2_MOUSE Ubiquitin carboxyl-terminal hydrolase 2 OS=Mus musculus GN=Usp2 PE=1 SV=2 1247 1393 2.0E-22
sp|Q4R6D3|UBP50_MACFA Putative ubiquitin carboxyl-terminal hydrolase 50 OS=Macaca fascicularis GN=USP50 PE=2 SV=1 1248 1393 2.0E-22
sp|A5PMR2|UBP33_DANRE Ubiquitin carboxyl-terminal hydrolase 33 OS=Danio rerio GN=usp33 PE=2 SV=1 1247 1395 9.0E-22
sp|Q70EL4|UBP43_HUMAN Ubiquitin carboxyl-terminal hydrolase 43 OS=Homo sapiens GN=USP43 PE=1 SV=2 574 854 1.0E-21
sp|O75604|UBP2_HUMAN Ubiquitin carboxyl-terminal hydrolase 2 OS=Homo sapiens GN=USP2 PE=1 SV=2 1247 1393 2.0E-21
sp|A7TGY3|UBP4_VANPO Ubiquitin carboxyl-terminal hydrolase 4 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DOA4 PE=3 SV=1 1251 1395 2.0E-21
sp|Q5UQR3|UBPL1_MIMIV Probable ubiquitin carboxyl-terminal hydrolase R319 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R319 PE=3 SV=1 1247 1395 5.0E-21
sp|Q91W36|UBP3_MOUSE Ubiquitin carboxyl-terminal hydrolase 3 OS=Mus musculus GN=Usp3 PE=2 SV=1 1204 1398 7.0E-21
sp|Q4R6D3|UBP50_MACFA Putative ubiquitin carboxyl-terminal hydrolase 50 OS=Macaca fascicularis GN=USP50 PE=2 SV=1 577 767 2.0E-20
sp|Q2KHV7|UBP2_BOVIN Ubiquitin carboxyl-terminal hydrolase 2 OS=Bos taurus GN=USP2 PE=2 SV=1 1247 1393 3.0E-20
sp|Q9HFS7|UBP4_KLULA Ubiquitin carboxyl-terminal hydrolase 4 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DOA4 PE=3 SV=1 1243 1395 4.0E-20
sp|A6ZY34|UBP4_YEAS7 Ubiquitin carboxyl-terminal hydrolase 4 OS=Saccharomyces cerevisiae (strain YJM789) GN=DOA4 PE=3 SV=1 1238 1395 2.0E-19
sp|Q8BUM9|UBP43_MOUSE Ubiquitin carboxyl-terminal hydrolase 43 OS=Mus musculus GN=Usp43 PE=1 SV=2 574 871 6.0E-19
sp|P32571|UBP4_YEAST Ubiquitin carboxyl-terminal hydrolase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DOA4 PE=1 SV=2 1238 1395 6.0E-19
sp|B3LGK1|UBP4_YEAS1 Ubiquitin carboxyl-terminal hydrolase 4 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=DOA4 PE=3 SV=1 1238 1395 6.0E-19
sp|Q2KJ72|UBP21_BOVIN Ubiquitin carboxyl-terminal hydrolase 21 OS=Bos taurus GN=USP21 PE=2 SV=1 1155 1394 6.0E-19
sp|Q754R5|UBP4_ASHGO Ubiquitin carboxyl-terminal hydrolase 4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DOA4 PE=3 SV=2 1244 1398 7.0E-19
sp|Q9UK80|UBP21_HUMAN Ubiquitin carboxyl-terminal hydrolase 21 OS=Homo sapiens GN=USP21 PE=1 SV=1 1247 1394 1.0E-18
sp|Q6FQF0|UBP4_CANGA Ubiquitin carboxyl-terminal hydrolase 4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DOA4 PE=3 SV=1 1249 1398 2.0E-18
sp|Q9QZL6|UBP21_MOUSE Ubiquitin carboxyl-terminal hydrolase 21 OS=Mus musculus GN=Usp21 PE=1 SV=1 1247 1394 2.0E-18
sp|B2GUX4|UBP21_RAT Ubiquitin carboxyl-terminal hydrolase 21 OS=Rattus norvegicus GN=Usp21 PE=2 SV=1 1247 1394 3.0E-18
sp|P39944|UBP5_YEAST Ubiquitin carboxyl-terminal hydrolase 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBP5 PE=1 SV=1 1243 1395 6.0E-18
sp|Q9SJA1|UBP19_ARATH Ubiquitin carboxyl-terminal hydrolase 19 OS=Arabidopsis thaliana GN=UBP19 PE=2 SV=2 1246 1439 2.0E-17
sp|Q9SB51|UBP16_ARATH Ubiquitin carboxyl-terminal hydrolase 16 OS=Arabidopsis thaliana GN=UBP16 PE=1 SV=1 1248 1407 2.0E-17
sp|Q6PAW2|UBP16_XENLA Ubiquitin carboxyl-terminal hydrolase 16 OS=Xenopus laevis GN=usp16 PE=2 SV=1 580 764 3.0E-17
sp|Q6P8X6|UBP50_MOUSE Putative ubiquitin carboxyl-terminal hydrolase 50 OS=Mus musculus GN=Usp50 PE=2 SV=1 577 765 5.0E-17
sp|Q9FPT5|UBP1_ARATH Ubiquitin carboxyl-terminal hydrolase 1 OS=Arabidopsis thaliana GN=UBP1 PE=1 SV=2 580 765 6.0E-17
sp|Q67XW5|UBP18_ARATH Ubiquitin carboxyl-terminal hydrolase 18 OS=Arabidopsis thaliana GN=UBP18 PE=2 SV=2 1248 1395 1.0E-16
sp|P50102|UBP8_YEAST Ubiquitin carboxyl-terminal hydrolase 8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBP8 PE=1 SV=1 1218 1396 1.0E-16
sp|Q70EK9|UBP51_HUMAN Ubiquitin carboxyl-terminal hydrolase 51 OS=Homo sapiens GN=USP51 PE=2 SV=1 1248 1396 7.0E-15
sp|Q9P275|UBP36_HUMAN Ubiquitin carboxyl-terminal hydrolase 36 OS=Homo sapiens GN=USP36 PE=1 SV=3 1204 1395 1.0E-14
sp|Q9VVR1|NOT_DROME Ubiquitin carboxyl-terminal hydrolase nonstop OS=Drosophila melanogaster GN=not PE=1 SV=3 1248 1395 1.0E-14
sp|P40453|UBP7_YEAST Ubiquitin carboxyl-terminal hydrolase 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBP7 PE=1 SV=1 580 769 2.0E-14
sp|Q9FPS4|UBP23_ARATH Ubiquitin carboxyl-terminal hydrolase 23 OS=Arabidopsis thaliana GN=UBP23 PE=2 SV=2 1248 1395 2.0E-14
sp|Q0VA64|UBP16_XENTR Ubiquitin carboxyl-terminal hydrolase 16 OS=Xenopus tropicalis GN=usp16 PE=2 SV=2 580 764 2.0E-14
sp|Q9FKP5|UBP17_ARATH Ubiquitin carboxyl-terminal hydrolase 17 OS=Arabidopsis thaliana GN=UBP17 PE=2 SV=1 1248 1401 2.0E-14
sp|Q8CEG8|UBP27_MOUSE Ubiquitin carboxyl-terminal hydrolase 27 OS=Mus musculus GN=Usp27 PE=2 SV=2 1248 1400 3.0E-14
sp|B1AQJ2|UBP36_MOUSE Ubiquitin carboxyl-terminal hydrolase 36 OS=Mus musculus GN=Usp36 PE=1 SV=1 1204 1395 3.0E-14
sp|O74442|UBP16_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubp16 PE=1 SV=1 1245 1398 3.0E-14
sp|A6NNY8|UBP27_HUMAN Ubiquitin carboxyl-terminal hydrolase 27 OS=Homo sapiens GN=USP27X PE=2 SV=3 1248 1396 3.0E-14
sp|Q70EL3|UBP50_HUMAN Inactive ubiquitin carboxyl-terminal hydrolase 50 OS=Homo sapiens GN=USP50 PE=2 SV=1 577 765 4.0E-14
sp|P0C8Z3|UBP22_BOVIN Ubiquitin carboxyl-terminal hydrolase 22 OS=Bos taurus GN=USP22 PE=2 SV=1 1248 1396 7.0E-14
sp|Q99LG0|UBP16_MOUSE Ubiquitin carboxyl-terminal hydrolase 16 OS=Mus musculus GN=Usp16 PE=1 SV=2 580 764 7.0E-14
sp|Q8K387|UBP45_MOUSE Ubiquitin carboxyl-terminal hydrolase 45 OS=Mus musculus GN=Usp45 PE=1 SV=1 1244 1395 8.0E-14
sp|Q8W4N3|UBP2_ARATH Ubiquitin carboxyl-terminal hydrolase 2 OS=Arabidopsis thaliana GN=UBP2 PE=1 SV=2 557 762 8.0E-14
sp|Q6GNI6|UB22A_XENLA Ubiquitin carboxyl-terminal hydrolase 22-A OS=Xenopus laevis GN=usp22-a PE=2 SV=1 1248 1396 8.0E-14
sp|Q08DA3|UBP16_BOVIN Ubiquitin carboxyl-terminal hydrolase 16 OS=Bos taurus GN=USP16 PE=2 SV=2 580 764 8.0E-14
sp|A8HAL1|UBP16_DANRE Ubiquitin carboxyl-terminal hydrolase 16 OS=Danio rerio GN=usp16 PE=3 SV=1 580 764 8.0E-14
sp|O60139|UBP4_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubp4 PE=1 SV=2 1247 1397 9.0E-14
sp|Q9FIQ1|UBP21_ARATH Ubiquitin carboxyl-terminal hydrolase 21 OS=Arabidopsis thaliana GN=UBP21 PE=2 SV=1 1248 1412 9.0E-14
sp|Q4R6X7|UBP16_MACFA Ubiquitin carboxyl-terminal hydrolase 16 OS=Macaca fascicularis GN=USP16 PE=2 SV=2 1239 1395 9.0E-14
sp|Q8NFA0|UBP32_HUMAN Ubiquitin carboxyl-terminal hydrolase 32 OS=Homo sapiens GN=USP32 PE=1 SV=1 1184 1330 1.0E-13
sp|Q9UPT9|UBP22_HUMAN Ubiquitin carboxyl-terminal hydrolase 22 OS=Homo sapiens GN=USP22 PE=1 SV=2 1248 1396 1.0E-13
sp|Q9Y5T5|UBP16_HUMAN Ubiquitin carboxyl-terminal hydrolase 16 OS=Homo sapiens GN=USP16 PE=1 SV=1 1239 1395 1.0E-13
sp|Q5DU02|UBP22_MOUSE Ubiquitin carboxyl-terminal hydrolase 22 OS=Mus musculus GN=Usp22 PE=2 SV=2 1248 1396 1.0E-13
sp|Q2KJ09|UBP16_RAT Ubiquitin carboxyl-terminal hydrolase 16 OS=Rattus norvegicus GN=Usp16 PE=1 SV=2 1228 1395 1.0E-13
sp|Q6P9L4|UBP49_MOUSE Ubiquitin carboxyl-terminal hydrolase 49 OS=Mus musculus GN=Usp49 PE=2 SV=1 1249 1397 1.0E-13
sp|A5PMR2|UBP33_DANRE Ubiquitin carboxyl-terminal hydrolase 33 OS=Danio rerio GN=usp33 PE=2 SV=1 574 709 2.0E-13
sp|Q70EL3|UBP50_HUMAN Inactive ubiquitin carboxyl-terminal hydrolase 50 OS=Homo sapiens GN=USP50 PE=2 SV=1 1248 1362 2.0E-13
sp|Q70CQ1|UBP49_HUMAN Ubiquitin carboxyl-terminal hydrolase 49 OS=Homo sapiens GN=USP49 PE=1 SV=1 1249 1408 2.0E-13
sp|A6H8I0|UBP22_DANRE Ubiquitin carboxyl-terminal hydrolase 22 OS=Danio rerio GN=usp22 PE=2 SV=1 1248 1396 2.0E-13
sp|Q6DCJ1|UB22B_XENLA Ubiquitin carboxyl-terminal hydrolase 22-B OS=Xenopus laevis GN=usp22-b PE=2 SV=2 1248 1396 2.0E-13
sp|Q91W36|UBP3_MOUSE Ubiquitin carboxyl-terminal hydrolase 3 OS=Mus musculus GN=Usp3 PE=2 SV=1 578 765 3.0E-13
sp|Q99LG0|UBP16_MOUSE Ubiquitin carboxyl-terminal hydrolase 16 OS=Mus musculus GN=Usp16 PE=1 SV=2 1239 1395 3.0E-13
sp|Q4R6X7|UBP16_MACFA Ubiquitin carboxyl-terminal hydrolase 16 OS=Macaca fascicularis GN=USP16 PE=2 SV=2 580 764 3.0E-13
sp|Q2KJ09|UBP16_RAT Ubiquitin carboxyl-terminal hydrolase 16 OS=Rattus norvegicus GN=Usp16 PE=1 SV=2 580 764 3.0E-13
sp|Q9FPS7|UBP20_ARATH Ubiquitin carboxyl-terminal hydrolase 20 OS=Arabidopsis thaliana GN=UBP20 PE=2 SV=1 1248 1448 3.0E-13
sp|Q9FPS9|UBP15_ARATH Ubiquitin carboxyl-terminal hydrolase 15 OS=Arabidopsis thaliana GN=UBP15 PE=2 SV=2 1248 1403 3.0E-13
sp|Q8K387|UBP45_MOUSE Ubiquitin carboxyl-terminal hydrolase 45 OS=Mus musculus GN=Usp45 PE=1 SV=1 565 774 4.0E-13
sp|Q9Y6I4|UBP3_HUMAN Ubiquitin carboxyl-terminal hydrolase 3 OS=Homo sapiens GN=USP3 PE=1 SV=2 578 765 5.0E-13
sp|Q08DA3|UBP16_BOVIN Ubiquitin carboxyl-terminal hydrolase 16 OS=Bos taurus GN=USP16 PE=2 SV=2 1239 1395 1.0E-12
sp|A8HAL1|UBP16_DANRE Ubiquitin carboxyl-terminal hydrolase 16 OS=Danio rerio GN=usp16 PE=3 SV=1 1247 1397 1.0E-12
sp|Q9Y5T5|UBP16_HUMAN Ubiquitin carboxyl-terminal hydrolase 16 OS=Homo sapiens GN=USP16 PE=1 SV=1 580 764 1.0E-12
sp|Q6NTR6|UP44A_XENLA Ubiquitin carboxyl-terminal hydrolase 44-A OS=Xenopus laevis GN=usp44-a PE=2 SV=1 1239 1396 1.0E-12
sp|Q9H9J4|UBP42_HUMAN Ubiquitin carboxyl-terminal hydrolase 42 OS=Homo sapiens GN=USP42 PE=1 SV=3 1248 1395 1.0E-12
sp|Q6QN14|U17L6_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 6 OS=Homo sapiens GN=USP17L6P PE=1 SV=2 560 762 1.0E-12
sp|B1AQJ2|UBP36_MOUSE Ubiquitin carboxyl-terminal hydrolase 36 OS=Mus musculus GN=Usp36 PE=1 SV=1 575 782 2.0E-12
sp|Q5XGZ2|UP44B_XENLA Ubiquitin carboxyl-terminal hydrolase 44-B OS=Xenopus laevis GN=usp44-b PE=2 SV=1 1239 1396 2.0E-12
sp|E1B9W9|UBP42_BOVIN Ubiquitin carboxyl-terminal hydrolase 42 OS=Bos taurus GN=USP42 PE=3 SV=1 1248 1403 2.0E-12
sp|A8MUK1|U17L5_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 5 OS=Homo sapiens GN=USP17L5 PE=3 SV=2 560 762 2.0E-12
sp|D6R901|U17LL_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 21 OS=Homo sapiens GN=USP17L21 PE=3 SV=1 560 762 2.0E-12
sp|Q0WX57|U17LO_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 24 OS=Homo sapiens GN=USP17L24 PE=1 SV=2 560 762 2.0E-12
sp|D6RJB6|U17LK_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 20 OS=Homo sapiens GN=USP17L20 PE=3 SV=1 560 762 2.0E-12
sp|D6RBQ6|U17LH_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 17 OS=Homo sapiens GN=USP17L17 PE=3 SV=1 560 762 2.0E-12
sp|C9JPN9|UL17C_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 12 OS=Homo sapiens GN=USP17L12 PE=3 SV=1 560 762 2.0E-12
sp|Q5REG5|UBP33_PONAB Ubiquitin carboxyl-terminal hydrolase 33 OS=Pongo abelii GN=USP33 PE=2 SV=1 574 686 3.0E-12
sp|Q9P275|UBP36_HUMAN Ubiquitin carboxyl-terminal hydrolase 36 OS=Homo sapiens GN=USP36 PE=1 SV=3 575 782 3.0E-12
sp|C9JVI0|U17LB_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 11 OS=Homo sapiens GN=USP17L11 PE=3 SV=1 560 762 3.0E-12
sp|D6RA61|U17LM_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 22 OS=Homo sapiens GN=USP17L22 PE=3 SV=1 560 762 3.0E-12
sp|D6R9N7|U17LI_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 18 OS=Homo sapiens GN=USP17L18 PE=3 SV=1 560 762 3.0E-12
sp|D6RCP7|U17LJ_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 19 OS=Homo sapiens GN=USP17L19 PE=3 SV=1 560 762 3.0E-12
sp|C9J2P7|U17LF_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 15 OS=Homo sapiens GN=USP17L15 PE=3 SV=1 560 762 3.0E-12
sp|D3ZU96|UBP42_RAT Ubiquitin carboxyl-terminal hydrolase 42 OS=Rattus norvegicus GN=Usp42 PE=1 SV=1 1248 1403 3.0E-12
sp|Q28CN3|UBP33_XENTR Ubiquitin carboxyl-terminal hydrolase 33 OS=Xenopus tropicalis GN=usp33 PE=2 SV=2 577 686 5.0E-12
sp|Q8R5K2|UBP33_MOUSE Ubiquitin carboxyl-terminal hydrolase 33 OS=Mus musculus GN=Usp33 PE=1 SV=2 577 686 6.0E-12
sp|Q8TEY7|UBP33_HUMAN Ubiquitin carboxyl-terminal hydrolase 33 OS=Homo sapiens GN=USP33 PE=1 SV=2 574 686 6.0E-12
sp|B4IXE0|UBP36_DROGR Ubiquitin carboxyl-terminal hydrolase 36 OS=Drosophila grimshawi GN=Usp36 PE=3 SV=1 579 796 6.0E-12
sp|Q5R5Z6|UBP20_PONAB Ubiquitin carboxyl-terminal hydrolase 20 OS=Pongo abelii GN=USP20 PE=2 SV=1 530 686 7.0E-12
sp|B2RQC2|UBP42_MOUSE Ubiquitin carboxyl-terminal hydrolase 42 OS=Mus musculus GN=Usp42 PE=1 SV=1 1248 1403 8.0E-12
sp|Q9WTV6|UBP18_MOUSE Ubl carboxyl-terminal hydrolase 18 OS=Mus musculus GN=Usp18 PE=1 SV=2 1248 1398 9.0E-12
sp|A6QNM7|UBP33_BOVIN Ubiquitin carboxyl-terminal hydrolase 33 OS=Bos taurus GN=USP33 PE=2 SV=1 577 686 1.0E-11
sp|Q9UMW8|UBP18_HUMAN Ubl carboxyl-terminal hydrolase 18 OS=Homo sapiens GN=USP18 PE=1 SV=1 1248 1395 1.0E-11
sp|C9JLJ4|U17LD_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 13 OS=Homo sapiens GN=USP17L13 PE=3 SV=1 561 762 1.0E-11
sp|P0C7I0|U17L8_HUMAN Inactive ubiquitin carboxyl-terminal hydrolase 17-like protein 8 OS=Homo sapiens GN=USP17L8 PE=3 SV=1 560 762 1.0E-11
sp|Q9FPS2|UBP25_ARATH Ubiquitin carboxyl-terminal hydrolase 25 OS=Arabidopsis thaliana GN=UBP25 PE=2 SV=1 1248 1400 1.0E-11
sp|A7Z056|UBP20_BOVIN Ubiquitin carboxyl-terminal hydrolase 20 OS=Bos taurus GN=USP20 PE=2 SV=1 577 686 2.0E-11
sp|Q9Y2K6|UBP20_HUMAN Ubiquitin carboxyl-terminal hydrolase 20 OS=Homo sapiens GN=USP20 PE=1 SV=2 577 686 2.0E-11
sp|Q8C6M1|UBP20_MOUSE Ubiquitin carboxyl-terminal hydrolase 20 OS=Mus musculus GN=Usp20 PE=1 SV=1 577 686 2.0E-11
sp|Q70EK9|UBP51_HUMAN Ubiquitin carboxyl-terminal hydrolase 51 OS=Homo sapiens GN=USP51 PE=2 SV=1 576 765 2.0E-11
sp|E7F6T8|UBP37_DANRE Ubiquitin carboxyl-terminal hydrolase 37 OS=Danio rerio GN=usp37 PE=2 SV=1 580 788 2.0E-11
sp|O24454|UBP3_ARATH Ubiquitin carboxyl-terminal hydrolase 3 OS=Arabidopsis thaliana GN=UBP3 PE=1 SV=1 1153 1400 2.0E-11
sp|B4LG38|UBP36_DROVI Ubiquitin carboxyl-terminal hydrolase 36 OS=Drosophila virilis GN=Usp36 PE=3 SV=1 578 796 2.0E-11
sp|Q6R6M4|U17L2_HUMAN Ubiquitin carboxyl-terminal hydrolase 17 OS=Homo sapiens GN=USP17L2 PE=1 SV=2 560 762 2.0E-11
sp|Q9H0E7|UBP44_HUMAN Ubiquitin carboxyl-terminal hydrolase 44 OS=Homo sapiens GN=USP44 PE=1 SV=2 1251 1396 2.0E-11
sp|B4KXJ5|UBP36_DROMO Ubiquitin carboxyl-terminal hydrolase 36 OS=Drosophila mojavensis GN=Usp36 PE=3 SV=1 578 796 3.0E-11
sp|Q70EL2|UBP45_HUMAN Ubiquitin carboxyl-terminal hydrolase 45 OS=Homo sapiens GN=USP45 PE=1 SV=3 495 781 3.0E-11
sp|P36026|UBP11_YEAST Ubiquitin carboxyl-terminal hydrolase 11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBP11 PE=3 SV=1 580 771 3.0E-11
sp|P53874|UBP10_YEAST Ubiquitin carboxyl-terminal hydrolase 10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBP10 PE=1 SV=2 1245 1395 3.0E-11
sp|P35125|UBP6_HUMAN Ubiquitin carboxyl-terminal hydrolase 6 OS=Homo sapiens GN=USP6 PE=1 SV=2 1184 1330 4.0E-11
sp|P0C8Z3|UBP22_BOVIN Ubiquitin carboxyl-terminal hydrolase 22 OS=Bos taurus GN=USP22 PE=2 SV=1 539 780 4.0E-11
sp|Q6GNI6|UB22A_XENLA Ubiquitin carboxyl-terminal hydrolase 22-A OS=Xenopus laevis GN=usp22-a PE=2 SV=1 577 780 4.0E-11
sp|Q9UPT9|UBP22_HUMAN Ubiquitin carboxyl-terminal hydrolase 22 OS=Homo sapiens GN=USP22 PE=1 SV=2 539 780 4.0E-11
sp|Q6DCJ1|UB22B_XENLA Ubiquitin carboxyl-terminal hydrolase 22-B OS=Xenopus laevis GN=usp22-b PE=2 SV=2 577 780 4.0E-11
sp|D2HBJ8|UBP44_AILME Ubiquitin carboxyl-terminal hydrolase 44 OS=Ailuropoda melanoleuca GN=USP44 PE=3 SV=1 1251 1396 4.0E-11
sp|Q5DU02|UBP22_MOUSE Ubiquitin carboxyl-terminal hydrolase 22 OS=Mus musculus GN=Usp22 PE=2 SV=2 539 780 5.0E-11
sp|A6H8I0|UBP22_DANRE Ubiquitin carboxyl-terminal hydrolase 22 OS=Danio rerio GN=usp22 PE=2 SV=1 539 780 5.0E-11
sp|B1AY13|UBP24_MOUSE Ubiquitin carboxyl-terminal hydrolase 24 OS=Mus musculus GN=Usp24 PE=1 SV=1 1248 1397 5.0E-11
sp|Q7ZUM8|UBP44_DANRE Ubiquitin carboxyl-terminal hydrolase 44 OS=Danio rerio GN=usp44 PE=2 SV=1 1249 1398 5.0E-11
sp|Q3LFD5|UBP41_HUMAN Putative ubiquitin carboxyl-terminal hydrolase 41 OS=Homo sapiens GN=USP41 PE=2 SV=2 1248 1378 5.0E-11
sp|Q9UPU5|UBP24_HUMAN Ubiquitin carboxyl-terminal hydrolase 24 OS=Homo sapiens GN=USP24 PE=1 SV=3 1248 1397 6.0E-11
sp|Q8C2S0|UBP44_MOUSE Ubiquitin carboxyl-terminal hydrolase 44 OS=Mus musculus GN=Usp44 PE=2 SV=3 1253 1396 8.0E-11
sp|Q8LAM0|UBP4_ARATH Ubiquitin carboxyl-terminal hydrolase 4 OS=Arabidopsis thaliana GN=UBP4 PE=1 SV=2 1248 1379 9.0E-11
sp|A0JM59|UBP20_XENTR Ubiquitin carboxyl-terminal hydrolase 20 OS=Xenopus tropicalis GN=usp20 PE=2 SV=1 577 686 1.0E-10
sp|C9J2P7|U17LF_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 15 OS=Homo sapiens GN=USP17L15 PE=3 SV=1 1248 1397 1.0E-10
sp|Q8NB14|UBP38_HUMAN Ubiquitin carboxyl-terminal hydrolase 38 OS=Homo sapiens GN=USP38 PE=1 SV=2 576 769 1.0E-10
sp|A6NCW7|U17L4_HUMAN Inactive ubiquitin carboxyl-terminal hydrolase 17-like protein 4 OS=Homo sapiens GN=USP17L4 PE=3 SV=3 560 762 1.0E-10
sp|B1WBD7|UBP20_XENLA Ubiquitin carboxyl-terminal hydrolase 20 OS=Xenopus laevis GN=usp20 PE=2 SV=1 577 686 2.0E-10
sp|Q8BW70|UBP38_MOUSE Ubiquitin carboxyl-terminal hydrolase 38 OS=Mus musculus GN=Usp38 PE=1 SV=2 576 762 2.0E-10
sp|Q7RTZ2|U17L1_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 1 OS=Homo sapiens GN=USP17L1 PE=3 SV=1 560 762 2.0E-10
sp|A6NCW0|U17L3_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 3 OS=Homo sapiens GN=USP17L3 PE=3 SV=1 560 762 2.0E-10
sp|A5PN09|UBP20_DANRE Ubiquitin carboxyl-terminal hydrolase 20 OS=Danio rerio GN=usp20 PE=3 SV=1 577 686 3.0E-10
sp|Q70EL2|UBP45_HUMAN Ubiquitin carboxyl-terminal hydrolase 45 OS=Homo sapiens GN=USP45 PE=1 SV=3 1244 1395 3.0E-10
sp|A6NNY8|UBP27_HUMAN Ubiquitin carboxyl-terminal hydrolase 27 OS=Homo sapiens GN=USP27X PE=2 SV=3 577 765 4.0E-10
sp|Q6QN14|U17L6_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 6 OS=Homo sapiens GN=USP17L6P PE=1 SV=2 1248 1397 5.0E-10
sp|D6RA61|U17LM_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 22 OS=Homo sapiens GN=USP17L22 PE=3 SV=1 1248 1397 5.0E-10
sp|Q9VVR1|NOT_DROME Ubiquitin carboxyl-terminal hydrolase nonstop OS=Drosophila melanogaster GN=not PE=1 SV=3 562 764 6.0E-10
sp|A6NCW0|U17L3_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 3 OS=Homo sapiens GN=USP17L3 PE=3 SV=1 1248 1397 6.0E-10
sp|Q9FPS2|UBP25_ARATH Ubiquitin carboxyl-terminal hydrolase 25 OS=Arabidopsis thaliana GN=UBP25 PE=2 SV=1 574 764 7.0E-10
sp|Q6R6M4|U17L2_HUMAN Ubiquitin carboxyl-terminal hydrolase 17 OS=Homo sapiens GN=USP17L2 PE=1 SV=2 1248 1397 7.0E-10
sp|Q8CEG8|UBP27_MOUSE Ubiquitin carboxyl-terminal hydrolase 27 OS=Mus musculus GN=Usp27 PE=2 SV=2 577 765 8.0E-10
sp|C9JVI0|U17LB_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 11 OS=Homo sapiens GN=USP17L11 PE=3 SV=1 1248 1397 8.0E-10
sp|D6R9N7|U17LI_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 18 OS=Homo sapiens GN=USP17L18 PE=3 SV=1 1248 1397 8.0E-10
sp|D6RCP7|U17LJ_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 19 OS=Homo sapiens GN=USP17L19 PE=3 SV=1 1248 1397 8.0E-10
sp|C9JJH3|U17LA_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 10 OS=Homo sapiens GN=USP17L10 PE=3 SV=1 1248 1397 8.0E-10
sp|A8MUK1|U17L5_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 5 OS=Homo sapiens GN=USP17L5 PE=3 SV=2 1248 1397 9.0E-10
sp|Q2LZB1|UBP36_DROPS Ubiquitin carboxyl-terminal hydrolase 36 OS=Drosophila pseudoobscura pseudoobscura GN=Usp36 PE=3 SV=2 578 762 9.0E-10
sp|D6R901|U17LL_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 21 OS=Homo sapiens GN=USP17L21 PE=3 SV=1 1248 1397 1.0E-09
sp|Q0WX57|U17LO_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 24 OS=Homo sapiens GN=USP17L24 PE=1 SV=2 1248 1397 1.0E-09
sp|D6RJB6|U17LK_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 20 OS=Homo sapiens GN=USP17L20 PE=3 SV=1 1248 1397 1.0E-09
sp|D6RBQ6|U17LH_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 17 OS=Homo sapiens GN=USP17L17 PE=3 SV=1 1248 1397 1.0E-09
sp|C9JPN9|UL17C_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 12 OS=Homo sapiens GN=USP17L12 PE=3 SV=1 1248 1397 1.0E-09
sp|C9JLJ4|U17LD_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 13 OS=Homo sapiens GN=USP17L13 PE=3 SV=1 1248 1397 1.0E-09
sp|Q61068|U17PA_MOUSE Ubiquitin carboxyl-terminal hydrolase 17-like protein A OS=Mus musculus GN=Usp17la PE=1 SV=1 578 764 1.0E-09
sp|P38187|UBP13_YEAST Ubiquitin carboxyl-terminal hydrolase 13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBP13 PE=1 SV=3 1249 1417 1.0E-09
sp|Q7RTZ2|U17L1_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 1 OS=Homo sapiens GN=USP17L1 PE=3 SV=1 1248 1397 2.0E-09
sp|Q0CT11|CREB_ASPTN Probable ubiquitin carboxyl-terminal hydrolase creB OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=creB PE=3 SV=2 1252 1394 2.0E-09
sp|Q4WQI1|CREB_ASPFU Probable ubiquitin carboxyl-terminal hydrolase creB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=creB PE=3 SV=3 1252 1394 2.0E-09
sp|B0Y4P5|CREB_ASPFC Probable ubiquitin carboxyl-terminal hydrolase creB OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=creB PE=3 SV=1 1252 1394 2.0E-09
sp|A1CW53|CREB_NEOFI Probable ubiquitin carboxyl-terminal hydrolase creB OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=creB PE=3 SV=2 1252 1394 2.0E-09
sp|A6NCW7|U17L4_HUMAN Inactive ubiquitin carboxyl-terminal hydrolase 17-like protein 4 OS=Homo sapiens GN=USP17L4 PE=3 SV=3 1248 1397 3.0E-09
sp|Q2UUG8|CREB_ASPOR Probable ubiquitin carboxyl-terminal hydrolase creB OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=creB PE=3 SV=2 1252 1394 3.0E-09
sp|B8NSV5|CREB_ASPFN Probable ubiquitin carboxyl-terminal hydrolase creB OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=creB PE=3 SV=1 1252 1394 3.0E-09
sp|Q9LEW0|UBP22_ARATH Ubiquitin carboxyl-terminal hydrolase 22 OS=Arabidopsis thaliana GN=UBP22 PE=2 SV=1 1248 1393 3.0E-09
sp|Q7M764|U17PE_MOUSE Ubiquitin carboxyl-terminal hydrolase 17-like protein E OS=Mus musculus GN=Usp17le PE=3 SV=2 1258 1397 3.0E-09
sp|Q8NFA0|UBP32_HUMAN Ubiquitin carboxyl-terminal hydrolase 32 OS=Homo sapiens GN=USP32 PE=1 SV=1 1328 1414 4.0E-09
sp|A1CIL1|CREB_ASPCL Probable ubiquitin carboxyl-terminal hydrolase creB OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=creB PE=3 SV=2 1252 1394 4.0E-09
sp|Q5M981|UB12B_XENLA Ubiquitin carboxyl-terminal hydrolase 12-B OS=Xenopus laevis GN=usp12-b PE=2 SV=2 1248 1396 5.0E-09
sp|Q52KZ6|UB12A_XENLA Ubiquitin carboxyl-terminal hydrolase 12-A OS=Xenopus laevis GN=usp12-a PE=2 SV=1 1248 1396 5.0E-09
sp|O75317|UBP12_HUMAN Ubiquitin carboxyl-terminal hydrolase 12 OS=Homo sapiens GN=USP12 PE=1 SV=2 1248 1396 5.0E-09
sp|A2Q9N1|CREB_ASPNC Probable ubiquitin carboxyl-terminal hydrolase creB OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=creB PE=3 SV=2 1252 1394 5.0E-09
sp|Q96V54|CREB_EMENI Ubiquitin carboxyl-terminal hydrolase creB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=creB PE=1 SV=1 1252 1394 6.0E-09
sp|A5D9H7|UBP12_BOVIN Ubiquitin carboxyl-terminal hydrolase 12 OS=Bos taurus GN=USP12 PE=2 SV=1 1248 1396 6.0E-09
sp|Q9D9M2|UBP12_MOUSE Ubiquitin carboxyl-terminal hydrolase 12 OS=Mus musculus GN=Usp12 PE=2 SV=2 1248 1396 7.0E-09
sp|Q8W4N3|UBP2_ARATH Ubiquitin carboxyl-terminal hydrolase 2 OS=Arabidopsis thaliana GN=UBP2 PE=1 SV=2 1277 1395 8.0E-09
sp|Q61068|U17PA_MOUSE Ubiquitin carboxyl-terminal hydrolase 17-like protein A OS=Mus musculus GN=Usp17la PE=1 SV=1 1248 1411 8.0E-09
sp|Q5RE63|UBP18_PONAB Ubl carboxyl-terminal hydrolase 18 OS=Pongo abelii GN=USP18 PE=2 SV=1 1213 1395 9.0E-09
sp|P35125|UBP6_HUMAN Ubiquitin carboxyl-terminal hydrolase 6 OS=Homo sapiens GN=USP6 PE=1 SV=2 1328 1414 2.0E-08
sp|E1BMF7|UBP13_BOVIN Ubiquitin carboxyl-terminal hydrolase 13 OS=Bos taurus GN=USP13 PE=3 SV=2 577 685 2.0E-08
sp|Q5BKP2|UBP13_MOUSE Ubiquitin carboxyl-terminal hydrolase 13 OS=Mus musculus GN=Usp13 PE=1 SV=1 577 685 2.0E-08
sp|Q92995|UBP13_HUMAN Ubiquitin carboxyl-terminal hydrolase 13 OS=Homo sapiens GN=USP13 PE=1 SV=2 577 685 2.0E-08
sp|A4FUN7|UBP12_DANRE Ubiquitin carboxyl-terminal hydrolase 12A OS=Danio rerio GN=usp12a PE=2 SV=1 1248 1396 3.0E-08
sp|E1C213|UBP37_CHICK Ubiquitin carboxyl-terminal hydrolase 37 OS=Gallus gallus GN=USP37 PE=3 SV=1 580 788 3.0E-08
sp|C0HB46|UBP12_SALSA Ubiquitin carboxyl-terminal hydrolase 12 OS=Salmo salar GN=usp12 PE=2 SV=1 1248 1396 3.0E-08
sp|Q5RBQ4|UBP46_PONAB Ubiquitin carboxyl-terminal hydrolase 46 OS=Pongo abelii GN=USP46 PE=2 SV=1 1248 1396 3.0E-08
sp|P62069|UBP46_MOUSE Ubiquitin carboxyl-terminal hydrolase 46 OS=Mus musculus GN=Usp46 PE=1 SV=1 1248 1396 3.0E-08
sp|P62068|UBP46_HUMAN Ubiquitin carboxyl-terminal hydrolase 46 OS=Homo sapiens GN=USP46 PE=1 SV=1 1248 1396 3.0E-08
sp|Q70CQ2|UBP34_HUMAN Ubiquitin carboxyl-terminal hydrolase 34 OS=Homo sapiens GN=USP34 PE=1 SV=2 1249 1374 5.0E-08
sp|Q9FPT5|UBP1_ARATH Ubiquitin carboxyl-terminal hydrolase 1 OS=Arabidopsis thaliana GN=UBP1 PE=1 SV=2 1277 1395 7.0E-08
sp|O96612|UBPB_DICDI Ubiquitin hydrolase B OS=Dictyostelium discoideum GN=ubpB PE=1 SV=1 1248 1394 9.0E-08
sp|P52479|UBP10_MOUSE Ubiquitin carboxyl-terminal hydrolase 10 OS=Mus musculus GN=Usp10 PE=1 SV=3 1236 1395 9.0E-08
sp|P0C7I0|U17L8_HUMAN Inactive ubiquitin carboxyl-terminal hydrolase 17-like protein 8 OS=Homo sapiens GN=USP17L8 PE=3 SV=1 1248 1397 1.0E-07
sp|Q2LZB1|UBP36_DROPS Ubiquitin carboxyl-terminal hydrolase 36 OS=Drosophila pseudoobscura pseudoobscura GN=Usp36 PE=3 SV=2 1248 1393 1.0E-07
sp|B4MLR8|UBP36_DROWI Ubiquitin carboxyl-terminal hydrolase 36 OS=Drosophila willistoni GN=Usp36 PE=3 SV=1 1248 1404 1.0E-07
sp|P0C7H9|U17L7_HUMAN Inactive ubiquitin carboxyl-terminal hydrolase 17-like protein 7 OS=Homo sapiens GN=USP17L7 PE=3 SV=1 1248 1397 1.0E-07
sp|F1SRY5|UBP37_PIG Ubiquitin carboxyl-terminal hydrolase 37 OS=Sus scrofa GN=USP37 PE=3 SV=1 580 765 1.0E-07
sp|A5WWB0|UBP46_DANRE Ubiquitin carboxyl-terminal hydrolase 46 OS=Danio rerio GN=usp46 PE=3 SV=2 1248 1396 1.0E-07
sp|Q3KR59|UBP10_RAT Ubiquitin carboxyl-terminal hydrolase 10 OS=Rattus norvegicus GN=Usp10 PE=1 SV=1 1240 1395 1.0E-07
sp|Q3V0C5|UBP48_MOUSE Ubiquitin carboxyl-terminal hydrolase 48 OS=Mus musculus GN=Usp48 PE=1 SV=2 1249 1374 1.0E-07
sp|Q86T82|UBP37_HUMAN Ubiquitin carboxyl-terminal hydrolase 37 OS=Homo sapiens GN=USP37 PE=1 SV=2 580 765 2.0E-07
sp|Q6ZQ93|UBP34_MOUSE Ubiquitin carboxyl-terminal hydrolase 34 OS=Mus musculus GN=Usp34 PE=1 SV=3 1249 1374 2.0E-07
sp|Q0V9G5|UBP44_XENTR Ubiquitin carboxyl-terminal hydrolase 44 OS=Xenopus tropicalis GN=usp44 PE=2 SV=1 1239 1360 2.0E-07
sp|Q86UV5|UBP48_HUMAN Ubiquitin carboxyl-terminal hydrolase 48 OS=Homo sapiens GN=USP48 PE=1 SV=1 1249 1374 2.0E-07
sp|Q14694|UBP10_HUMAN Ubiquitin carboxyl-terminal hydrolase 10 OS=Homo sapiens GN=USP10 PE=1 SV=2 1236 1395 2.0E-07
sp|D6RBM5|U17LN_HUMAN Putative ubiquitin carboxyl-terminal hydrolase 17-like protein 23 OS=Homo sapiens GN=USP17L23 PE=5 SV=1 560 684 2.0E-07
sp|Q76LT8|UBP48_RAT Ubiquitin carboxyl-terminal hydrolase 48 OS=Rattus norvegicus GN=Usp48 PE=1 SV=1 1249 1374 2.0E-07
sp|Q5ZM45|UBP48_CHICK Ubiquitin carboxyl-terminal hydrolase 48 OS=Gallus gallus GN=USP48 PE=2 SV=1 1249 1454 2.0E-07
sp|F1N5V1|UBP37_BOVIN Ubiquitin carboxyl-terminal hydrolase 37 OS=Bos taurus GN=USP37 PE=3 SV=1 580 765 3.0E-07
sp|Q3TIX9|SNUT2_MOUSE U4/U6.U5 tri-snRNP-associated protein 2 OS=Mus musculus GN=Usp39 PE=1 SV=2 1281 1396 3.0E-07
sp|Q5R761|SNUT2_PONAB U4/U6.U5 tri-snRNP-associated protein 2 OS=Pongo abelii GN=USP39 PE=2 SV=1 1281 1396 5.0E-07
sp|Q53GS9|SNUT2_HUMAN U4/U6.U5 tri-snRNP-associated protein 2 OS=Homo sapiens GN=USP39 PE=1 SV=2 1281 1396 5.0E-07
sp|Q8C0R0|UBP37_MOUSE Ubiquitin carboxyl-terminal hydrolase 37 OS=Mus musculus GN=Usp37 PE=1 SV=1 580 765 6.0E-07
sp|Q949Y0|UBP6_ARATH Ubiquitin carboxyl-terminal hydrolase 6 OS=Arabidopsis thaliana GN=UBP6 PE=1 SV=1 578 686 6.0E-07
sp|Q09738|UBP8_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubp8 PE=3 SV=1 1219 1396 8.0E-07
sp|E2RK09|UBP37_CANLF Ubiquitin carboxyl-terminal hydrolase 37 OS=Canis lupus familiaris GN=USP37 PE=3 SV=1 580 765 1.0E-06
sp|O24454|UBP3_ARATH Ubiquitin carboxyl-terminal hydrolase 3 OS=Arabidopsis thaliana GN=UBP3 PE=1 SV=1 580 764 3.0E-06
sp|P34547|UBP46_CAEEL Ubiquitin carboxyl-terminal hydrolase 46 OS=Caenorhabditis elegans GN=usp-46 PE=1 SV=3 1245 1374 3.0E-06
sp|Q93008|USP9X_HUMAN Probable ubiquitin carboxyl-terminal hydrolase FAF-X OS=Homo sapiens GN=USP9X PE=1 SV=3 1248 1374 3.0E-06
sp|P70398|USP9X_MOUSE Probable ubiquitin carboxyl-terminal hydrolase FAF-X OS=Mus musculus GN=Usp9x PE=1 SV=2 1248 1374 3.0E-06
sp|Q9P2H5|UBP35_HUMAN Ubiquitin carboxyl-terminal hydrolase 35 OS=Homo sapiens GN=USP35 PE=1 SV=3 576 685 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016579 protein deubiquitination Yes
GO:0036459 thiol-dependent ubiquitinyl hydrolase activity Yes
GO:0004843 thiol-dependent ubiquitin-specific protease activity Yes
GO:0071704 organic substance metabolic process No
GO:0006508 proteolysis No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0101005 ubiquitinyl hydrolase activity No
GO:0044267 cellular protein metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0044260 cellular macromolecule metabolic process No
GO:0070646 protein modification by small protein removal No
GO:0036211 protein modification process No
GO:0003674 molecular_function No
GO:0070647 protein modification by small protein conjugation or removal No
GO:0006464 cellular protein modification process No
GO:0070011 peptidase activity, acting on L-amino acid peptides No
GO:0043170 macromolecule metabolic process No
GO:0044237 cellular metabolic process No
GO:0043412 macromolecule modification No
GO:0140096 catalytic activity, acting on a protein No
GO:0019783 ubiquitin-like protein-specific protease activity No
GO:0008233 peptidase activity No
GO:0019538 protein metabolic process No
GO:0008234 cysteine-type peptidase activity No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:1901564 organonitrogen compound metabolic process No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 46 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1018
LPGQLTVKTSSSKKRKLARPPSTKDLGSPSPPSPDTALPSCEPDDDLALSFSAPSAASGLNTPLYVRADSLPASS
LPARLQTHASSLVSVEYASSVASSSPCASAYAELSLESDRGGEEGGPVPTSARSQSPFRVSRRAVMNGDAELHRR
SSSPLKRRASGMDPETKTGNNGPDAEMAKSQPTNRVDDSSVPTTTSLPRAMSIDPPEPNGYDAEAAVSSQSPPPL
LEQVKIIEMLLKAFAEAPVKEGCLAYLVSRSWVNQALALRTDSKSSVADSGDASLGPIDNSDIIDEVVRDSTGQS
FVRLKPGSGLESFELFPEDAWKLVMDWYGIKQGQDPIVRVAVNTANSKQDPPNIMFEFHPPVFSVYRLWSQVSPL
PIEQSLKARNPPPLVFARSSTAHAQTFLRELKTQAGIPLERKVRLFMVPPTVELAPASHPTELQPAALTPPDSPG
AQGANQPQHAWRNLLLDIASFSQVRDSRVLVTLADSTANEKFNGQTSLQHYNLTTDQILVLDEAIGAYWVSKYTG
QEKVAEKSIPSRAGIAAPFSSSKSNSNRSSPARDGPLTRGRAQKKRLGRRTGAVGLHNLGNTCYMNSALQCVRSV
EELTKYFLTESHLPEINDTNVLGYEGRVAIAYGNLLREIHEEGRTAVSPRDFKATVGRCRPTFSGWGQQDSQEFL
GFLLDALQEDLSRIKKKPYIEKPDSTDDMINNPEAIREMADKVWDITRRRDDSVIADLFTGMYKSTLKCPECGKI
SITFDPFNNLTLPLPLENMWSRPVKFFPLNDVPVKIDVELSKHSSMESLKQFISDRTGVPTDRLMGAEEFKDRFF
KIYDNSQDVSDEIQQSDTPTMHELEAPPTNWPGKAPRKKYRSMLDVDSPLDSVEPDDEQCATMVVPVLHRRPQML
GRGLEGVSPPHFITLSRKEAFSLDAIQRKVLEKVATFSTWSRLSDASTHENGSADSTEGDMVIATASDADSSGDS
KVAARSVVGEDDMVDITMKDAHARPGSKPTPLKRFNTRRPAFANPDSFLDPDLQNLFELCYFRSDSDGLVPTGWS
SVDNTCPLPKLSDRVPDVKETDQASPGSVSSTVSGNDDSSNEDEVGPDTPQTRMTEESSDEDASPAARFAVRPGR
RDQKFGAGGRKKFKSHRTYGKKGNKRRDKQVRAGKNSHRAPPAAVSPQPMPPAVADGGPLVRLYEGIVVDWNEDA
WETVFGNMSRRYDAAQGARTFTDPESLHDPALKMNQKKRQTRKTRGITLEECLDEFERAEVLSEQDMWYCPRCKE
HRRASKKFDLWKTPDILVAHLKRFSNSGWRREKLDVLVDFPIENLDLTSRVIQKEDGKVEVYDLIGVDDHYGGLG
GGHYTAYAKNFVDRRWYSFNDSSVHVVSDPTSIVTSAAYLLFYRRRSSGPLGGPRFAEILDKYDRENGLSDEENA
ESGEDGRAPARGAGRQTVKPDEDELPPYDETIRRSIEGDGEETSDGYHELGSKSLDMTQGWNFNGLDSRGGEGST
GGDCGSDDAQFDSSGDDRARDFFEQDTDMASSAAVEESAGWEGQGVIAVPARAGSEGDSDEVTEIHLEGDKAGRR
Q*
Coding >Hirsu2|1018
CTGCCCGGGCAGCTCACTGTCAAGACGTCTTCCTCAAAGAAGAGAAAGCTGGCCCGCCCGCCCTCGACCAAGGAT
CTCGGCTCTCCCAGCCCTCCGTCTCCCGACACGGCCCTGCCCTCGTGCGAGCCCGACGACGACCTAGCCCTCTCC
TTCTCCGCCCCGTCCGCAGCCTCCGGGCTCAACACGCCCCTCTACGTCCGCGCCGACTCGCTCCCGGCCTCGAGC
CTGCCCGCCCGGCTGCAGACGCACGCGTCCTCCCTCGTCTCCGTCGAGTACGCTTCTTCCGTCGCCTCGTCGTCC
CCCTGCGCCTCGGCCTACGCCGAACTCTCCCTCGAGAGCGACAGAGGAGGTGAAGAGGGTGGCCCTGTCCCGACC
TCGGCCAGAAGCCAGTCCCCCTTCCGAGTCTCGAGACGGGCTGTCATGAACGGCGATGCCGAGCTGCATCGTCGT
TCCTCCTCGCCGCTCAAACGACGTGCCTCAGGCATGGATCCCGAAACAAAGACCGGCAATAACGGCCCCGACGCA
GAAATGGCCAAGTCTCAGCCTACAAATCGTGTCGACGATTCTTCCGTACCCACCACCACCAGTCTTCCTCGCGCC
ATGAGCATCGACCCGCCGGAGCCCAACGGCTACGATGCAGAAGCAGCCGTATCGTCTCAATCTCCCCCTCCGCTC
CTGGAGCAAGTCAAGATCATCGAGATGCTGTTGAAAGCCTTTGCCGAAGCGCCCGTCAAGGAGGGCTGCCTGGCA
TATCTCGTCTCGCGATCGTGGGTGAACCAGGCCCTGGCCCTGCGTACGGACTCCAAATCGTCCGTGGCCGATTCC
GGAGACGCCTCGTTGGGCCCCATTGACAACTCCGACATCATCGACGAGGTCGTCCGCGACTCGACCGGCCAAAGC
TTCGTCCGCCTGAAGCCCGGCTCCGGGCTCGAGTCCTTCGAGCTGTTCCCCGAGGACGCTTGGAAGCTCGTGATG
GACTGGTACGGAATCAAGCAGGGCCAGGACCCCATCGTGCGCGTCGCCGTCAACACCGCCAACAGCAAACAAGAC
CCGCCCAACATCATGTTCGAGTTCCATCCGCCCGTCTTCAGCGTCTACCGGCTCTGGTCCCAGGTCAGCCCGCTG
CCGATAGAGCAGTCGCTCAAGGCCAGGAATCCGCCGCCGCTCGTCTTCGCCAGGAGCTCCACCGCGCACGCCCAG
ACGTTTCTCAGGGAGCTCAAGACTCAGGCCGGCATTCCCTTGGAACGCAAGGTTCGACTGTTCATGGTCCCTCCG
ACCGTGGAACTGGCCCCGGCCAGTCACCCCACGGAGCTGCAGCCTGCCGCCCTCACGCCGCCCGACTCTCCCGGA
GCCCAGGGAGCCAATCAGCCGCAGCACGCCTGGCGCAACCTCCTCCTCGACATCGCCAGCTTTTCTCAAGTCCGC
GACTCGAGGGTCTTGGTCACCCTGGCGGACAGCACGGCGAATGAGAAATTCAACGGCCAGACGTCCCTCCAGCAC
TACAACCTGACAACCGACCAGATACTCGTCCTCGACGAGGCCATCGGCGCGTACTGGGTCAGCAAATACACGGGA
CAGGAGAAGGTGGCGGAAAAGTCGATACCGTCGAGGGCCGGCATCGCCGCCCCCTTCTCCTCATCCAAGTCCAAC
AGCAACAGGAGCAGCCCGGCCCGCGACGGCCCGCTCACCCGCGGGCGGGCCCAAAAGAAGCGGCTCGGCCGGCGC
ACAGGGGCCGTCGGCCTGCACAACCTGGGAAACACGTGCTACATGAACTCCGCCTTGCAGTGTGTCCGCAGCGTG
GAAGAACTGACCAAATACTTCTTGACGGAATCCCACCTCCCCGAGATCAACGACACCAACGTCCTGGGCTACGAA
GGCAGAGTGGCGATAGCGTACGGCAACCTCCTCAGGGAGATACACGAGGAAGGGAGAACGGCCGTGAGCCCGCGC
GACTTCAAGGCCACCGTCGGCCGCTGCCGCCCCACCTTCTCGGGATGGGGCCAGCAGGACTCCCAGGAGTTCCTG
GGATTCCTGCTCGATGCCCTGCAGGAGGACCTGAGCCGCATCAAGAAGAAGCCGTACATCGAAAAGCCCGATTCC
ACGGACGACATGATCAACAATCCGGAGGCGATCCGGGAGATGGCAGACAAGGTGTGGGACATCACGCGCCGACGG
GACGACTCCGTCATCGCCGATCTCTTCACCGGCATGTACAAGTCGACGCTCAAGTGCCCCGAGTGCGGCAAGATC
AGCATCACCTTCGACCCGTTCAACAACCTGACCCTGCCGCTGCCGTTGGAGAACATGTGGTCCAGGCCCGTCAAG
TTCTTCCCGCTGAACGACGTGCCGGTCAAGATCGACGTGGAGCTGTCCAAGCACAGCTCCATGGAGAGTCTCAAG
CAGTTCATCTCGGACCGGACCGGCGTTCCCACCGACCGGCTGATGGGGGCCGAGGAGTTCAAGGATCGCTTCTTC
AAGATCTACGACAACAGCCAAGACGTCTCGGACGAGATCCAGCAGTCGGACACGCCGACAATGCATGAGCTGGAG
GCCCCCCCGACGAACTGGCCGGGCAAGGCTCCGCGGAAGAAGTACCGCTCCATGCTCGACGTCGACTCGCCCCTG
GATTCCGTCGAGCCGGACGACGAGCAGTGCGCCACCATGGTCGTCCCTGTCCTCCATCGCCGTCCCCAGATGCTC
GGGCGGGGGCTCGAGGGAGTCTCGCCTCCCCATTTCATCACATTGAGCAGAAAGGAGGCATTCAGTCTGGACGCC
ATACAGCGCAAGGTGCTCGAGAAGGTGGCCACCTTCTCCACCTGGTCCAGGCTCTCCGACGCCTCCACTCACGAG
AACGGGAGCGCGGACTCGACCGAGGGCGACATGGTCATCGCCACGGCCTCGGATGCCGATTCTTCCGGAGACAGC
AAGGTCGCCGCCCGCTCGGTGGTGGGCGAGGACGACATGGTCGACATCACGATGAAGGACGCGCACGCCCGGCCC
GGCTCGAAGCCGACCCCGCTGAAGCGCTTCAACACGCGCCGACCCGCGTTTGCCAACCCGGACAGCTTCCTCGAC
CCGGATCTCCAGAACCTCTTCGAGCTGTGCTACTTCCGGAGTGATTCGGACGGCCTCGTGCCGACCGGGTGGTCC
AGCGTCGACAACACCTGCCCGTTGCCCAAGCTGTCCGACCGCGTTCCCGACGTCAAGGAGACGGACCAGGCCAGC
CCGGGCAGCGTGAGCAGCACGGTCTCGGGCAACGACGACAGCAGCAACGAGGACGAGGTCGGACCGGACACGCCC
CAGACGCGCATGACGGAAGAGTCGAGCGACGAAGACGCCTCCCCGGCTGCCAGGTTCGCAGTTCGCCCCGGTCGT
CGGGACCAGAAGTTCGGAGCCGGCGGGCGCAAGAAGTTCAAGAGCCACAGGACGTACGGTAAGAAGGGTAACAAG
CGCCGTGACAAGCAGGTGCGGGCCGGCAAGAACTCGCACCGCGCGCCTCCGGCCGCCGTGAGCCCGCAGCCAATG
CCCCCGGCCGTGGCGGACGGGGGGCCGCTCGTCCGGCTCTACGAGGGCATCGTCGTCGACTGGAACGAGGATGCC
TGGGAGACGGTCTTCGGCAACATGTCGAGACGCTACGACGCGGCGCAGGGAGCCCGGACGTTTACGGATCCCGAG
TCGCTCCATGACCCGGCCCTCAAGATGAACCAGAAAAAGAGGCAGACGCGGAAGACTAGAGGCATCACGCTGGAA
GAGTGCCTGGACGAGTTCGAGCGCGCCGAGGTGCTGTCGGAGCAAGACATGTGGTACTGCCCACGGTGCAAGGAG
CACCGACGGGCAAGCAAGAAGTTCGACCTGTGGAAGACACCTGACATCCTCGTCGCCCACCTCAAGCGATTTAGC
AACTCCGGGTGGCGCCGAGAGAAGCTGGATGTCCTCGTCGACTTCCCCATCGAAAACCTGGACCTCACGTCGAGG
GTGATACAAAAGGAGGACGGCAAAGTCGAGGTCTACGACCTGATCGGCGTCGACGACCACTACGGAGGCCTCGGC
GGCGGCCACTACACCGCCTACGCCAAGAACTTCGTCGACAGGCGGTGGTACAGCTTCAACGACTCTTCGGTACAT
GTCGTGTCGGACCCCACATCCATCGTCACGAGCGCCGCGTACCTGCTCTTCTACCGCAGACGCTCCAGCGGCCCC
CTGGGAGGACCGCGATTCGCGGAGATCCTGGACAAGTACGACAGGGAGAATGGCCTGTCTGACGAGGAAAACGCA
GAGTCGGGCGAAGACGGGCGGGCGCCGGCAAGAGGCGCCGGCAGGCAGACTGTCAAGCCAGACGAGGACGAGCTC
CCGCCCTACGACGAGACGATCCGCCGGAGCATCGAAGGCGACGGAGAGGAGACGTCGGACGGGTACCACGAGCTA
GGGTCGAAATCGCTGGATATGACGCAGGGTTGGAACTTCAACGGGCTGGACAGCCGAGGGGGCGAAGGATCGACG
GGGGGCGATTGCGGCAGCGACGACGCCCAGTTCGACTCATCGGGCGATGACCGAGCCCGTGACTTCTTCGAGCAG
GACACGGACATGGCGTCGAGCGCGGCGGTTGAGGAAAGTGCGGGCTGGGAGGGCCAGGGGGTCATTGCGGTGCCG
GCGCGAGCCGGCAGCGAAGGCGACTCGGACGAAGTGACGGAGATTCACCTCGAGGGCGACAAGGCAGGTCGCCGG
CAGTGA
Transcript >Hirsu2|1018
CTGCCCGGGCAGCTCACTGTCAAGACGTCTTCCTCAAAGAAGAGAAAGCTGGCCCGCCCGCCCTCGACCAAGGAT
CTCGGCTCTCCCAGCCCTCCGTCTCCCGACACGGCCCTGCCCTCGTGCGAGCCCGACGACGACCTAGCCCTCTCC
TTCTCCGCCCCGTCCGCAGCCTCCGGGCTCAACACGCCCCTCTACGTCCGCGCCGACTCGCTCCCGGCCTCGAGC
CTGCCCGCCCGGCTGCAGACGCACGCGTCCTCCCTCGTCTCCGTCGAGTACGCTTCTTCCGTCGCCTCGTCGTCC
CCCTGCGCCTCGGCCTACGCCGAACTCTCCCTCGAGAGCGACAGAGGAGGTGAAGAGGGTGGCCCTGTCCCGACC
TCGGCCAGAAGCCAGTCCCCCTTCCGAGTCTCGAGACGGGCTGTCATGAACGGCGATGCCGAGCTGCATCGTCGT
TCCTCCTCGCCGCTCAAACGACGTGCCTCAGGCATGGATCCCGAAACAAAGACCGGCAATAACGGCCCCGACGCA
GAAATGGCCAAGTCTCAGCCTACAAATCGTGTCGACGATTCTTCCGTACCCACCACCACCAGTCTTCCTCGCGCC
ATGAGCATCGACCCGCCGGAGCCCAACGGCTACGATGCAGAAGCAGCCGTATCGTCTCAATCTCCCCCTCCGCTC
CTGGAGCAAGTCAAGATCATCGAGATGCTGTTGAAAGCCTTTGCCGAAGCGCCCGTCAAGGAGGGCTGCCTGGCA
TATCTCGTCTCGCGATCGTGGGTGAACCAGGCCCTGGCCCTGCGTACGGACTCCAAATCGTCCGTGGCCGATTCC
GGAGACGCCTCGTTGGGCCCCATTGACAACTCCGACATCATCGACGAGGTCGTCCGCGACTCGACCGGCCAAAGC
TTCGTCCGCCTGAAGCCCGGCTCCGGGCTCGAGTCCTTCGAGCTGTTCCCCGAGGACGCTTGGAAGCTCGTGATG
GACTGGTACGGAATCAAGCAGGGCCAGGACCCCATCGTGCGCGTCGCCGTCAACACCGCCAACAGCAAACAAGAC
CCGCCCAACATCATGTTCGAGTTCCATCCGCCCGTCTTCAGCGTCTACCGGCTCTGGTCCCAGGTCAGCCCGCTG
CCGATAGAGCAGTCGCTCAAGGCCAGGAATCCGCCGCCGCTCGTCTTCGCCAGGAGCTCCACCGCGCACGCCCAG
ACGTTTCTCAGGGAGCTCAAGACTCAGGCCGGCATTCCCTTGGAACGCAAGGTTCGACTGTTCATGGTCCCTCCG
ACCGTGGAACTGGCCCCGGCCAGTCACCCCACGGAGCTGCAGCCTGCCGCCCTCACGCCGCCCGACTCTCCCGGA
GCCCAGGGAGCCAATCAGCCGCAGCACGCCTGGCGCAACCTCCTCCTCGACATCGCCAGCTTTTCTCAAGTCCGC
GACTCGAGGGTCTTGGTCACCCTGGCGGACAGCACGGCGAATGAGAAATTCAACGGCCAGACGTCCCTCCAGCAC
TACAACCTGACAACCGACCAGATACTCGTCCTCGACGAGGCCATCGGCGCGTACTGGGTCAGCAAATACACGGGA
CAGGAGAAGGTGGCGGAAAAGTCGATACCGTCGAGGGCCGGCATCGCCGCCCCCTTCTCCTCATCCAAGTCCAAC
AGCAACAGGAGCAGCCCGGCCCGCGACGGCCCGCTCACCCGCGGGCGGGCCCAAAAGAAGCGGCTCGGCCGGCGC
ACAGGGGCCGTCGGCCTGCACAACCTGGGAAACACGTGCTACATGAACTCCGCCTTGCAGTGTGTCCGCAGCGTG
GAAGAACTGACCAAATACTTCTTGACGGAATCCCACCTCCCCGAGATCAACGACACCAACGTCCTGGGCTACGAA
GGCAGAGTGGCGATAGCGTACGGCAACCTCCTCAGGGAGATACACGAGGAAGGGAGAACGGCCGTGAGCCCGCGC
GACTTCAAGGCCACCGTCGGCCGCTGCCGCCCCACCTTCTCGGGATGGGGCCAGCAGGACTCCCAGGAGTTCCTG
GGATTCCTGCTCGATGCCCTGCAGGAGGACCTGAGCCGCATCAAGAAGAAGCCGTACATCGAAAAGCCCGATTCC
ACGGACGACATGATCAACAATCCGGAGGCGATCCGGGAGATGGCAGACAAGGTGTGGGACATCACGCGCCGACGG
GACGACTCCGTCATCGCCGATCTCTTCACCGGCATGTACAAGTCGACGCTCAAGTGCCCCGAGTGCGGCAAGATC
AGCATCACCTTCGACCCGTTCAACAACCTGACCCTGCCGCTGCCGTTGGAGAACATGTGGTCCAGGCCCGTCAAG
TTCTTCCCGCTGAACGACGTGCCGGTCAAGATCGACGTGGAGCTGTCCAAGCACAGCTCCATGGAGAGTCTCAAG
CAGTTCATCTCGGACCGGACCGGCGTTCCCACCGACCGGCTGATGGGGGCCGAGGAGTTCAAGGATCGCTTCTTC
AAGATCTACGACAACAGCCAAGACGTCTCGGACGAGATCCAGCAGTCGGACACGCCGACAATGCATGAGCTGGAG
GCCCCCCCGACGAACTGGCCGGGCAAGGCTCCGCGGAAGAAGTACCGCTCCATGCTCGACGTCGACTCGCCCCTG
GATTCCGTCGAGCCGGACGACGAGCAGTGCGCCACCATGGTCGTCCCTGTCCTCCATCGCCGTCCCCAGATGCTC
GGGCGGGGGCTCGAGGGAGTCTCGCCTCCCCATTTCATCACATTGAGCAGAAAGGAGGCATTCAGTCTGGACGCC
ATACAGCGCAAGGTGCTCGAGAAGGTGGCCACCTTCTCCACCTGGTCCAGGCTCTCCGACGCCTCCACTCACGAG
AACGGGAGCGCGGACTCGACCGAGGGCGACATGGTCATCGCCACGGCCTCGGATGCCGATTCTTCCGGAGACAGC
AAGGTCGCCGCCCGCTCGGTGGTGGGCGAGGACGACATGGTCGACATCACGATGAAGGACGCGCACGCCCGGCCC
GGCTCGAAGCCGACCCCGCTGAAGCGCTTCAACACGCGCCGACCCGCGTTTGCCAACCCGGACAGCTTCCTCGAC
CCGGATCTCCAGAACCTCTTCGAGCTGTGCTACTTCCGGAGTGATTCGGACGGCCTCGTGCCGACCGGGTGGTCC
AGCGTCGACAACACCTGCCCGTTGCCCAAGCTGTCCGACCGCGTTCCCGACGTCAAGGAGACGGACCAGGCCAGC
CCGGGCAGCGTGAGCAGCACGGTCTCGGGCAACGACGACAGCAGCAACGAGGACGAGGTCGGACCGGACACGCCC
CAGACGCGCATGACGGAAGAGTCGAGCGACGAAGACGCCTCCCCGGCTGCCAGGTTCGCAGTTCGCCCCGGTCGT
CGGGACCAGAAGTTCGGAGCCGGCGGGCGCAAGAAGTTCAAGAGCCACAGGACGTACGGTAAGAAGGGTAACAAG
CGCCGTGACAAGCAGGTGCGGGCCGGCAAGAACTCGCACCGCGCGCCTCCGGCCGCCGTGAGCCCGCAGCCAATG
CCCCCGGCCGTGGCGGACGGGGGGCCGCTCGTCCGGCTCTACGAGGGCATCGTCGTCGACTGGAACGAGGATGCC
TGGGAGACGGTCTTCGGCAACATGTCGAGACGCTACGACGCGGCGCAGGGAGCCCGGACGTTTACGGATCCCGAG
TCGCTCCATGACCCGGCCCTCAAGATGAACCAGAAAAAGAGGCAGACGCGGAAGACTAGAGGCATCACGCTGGAA
GAGTGCCTGGACGAGTTCGAGCGCGCCGAGGTGCTGTCGGAGCAAGACATGTGGTACTGCCCACGGTGCAAGGAG
CACCGACGGGCAAGCAAGAAGTTCGACCTGTGGAAGACACCTGACATCCTCGTCGCCCACCTCAAGCGATTTAGC
AACTCCGGGTGGCGCCGAGAGAAGCTGGATGTCCTCGTCGACTTCCCCATCGAAAACCTGGACCTCACGTCGAGG
GTGATACAAAAGGAGGACGGCAAAGTCGAGGTCTACGACCTGATCGGCGTCGACGACCACTACGGAGGCCTCGGC
GGCGGCCACTACACCGCCTACGCCAAGAACTTCGTCGACAGGCGGTGGTACAGCTTCAACGACTCTTCGGTACAT
GTCGTGTCGGACCCCACATCCATCGTCACGAGCGCCGCGTACCTGCTCTTCTACCGCAGACGCTCCAGCGGCCCC
CTGGGAGGACCGCGATTCGCGGAGATCCTGGACAAGTACGACAGGGAGAATGGCCTGTCTGACGAGGAAAACGCA
GAGTCGGGCGAAGACGGGCGGGCGCCGGCAAGAGGCGCCGGCAGGCAGACTGTCAAGCCAGACGAGGACGAGCTC
CCGCCCTACGACGAGACGATCCGCCGGAGCATCGAAGGCGACGGAGAGGAGACGTCGGACGGGTACCACGAGCTA
GGGTCGAAATCGCTGGATATGACGCAGGGTTGGAACTTCAACGGGCTGGACAGCCGAGGGGGCGAAGGATCGACG
GGGGGCGATTGCGGCAGCGACGACGCCCAGTTCGACTCATCGGGCGATGACCGAGCCCGTGACTTCTTCGAGCAG
GACACGGACATGGCGTCGAGCGCGGCGGTTGAGGAAAGTGCGGGCTGGGAGGGCCAGGGGGTCATTGCGGTGCCG
GCGCGAGCCGGCAGCGAAGGCGACTCGGACGAAGTGACGGAGATTCACCTCGAGGGCGACAAGGCAGGTCGCCGG
CAGTGA
Gene >Hirsu2|1018
CTGCCCGGGCAGCTCACTGTCAAGACGTCTTCCTCAAAGAAGAGAAAGCTGGCCCGCCCGCCCTCGACCAAGGAT
CTCGGCTCTCCCAGCCCTCCGTCTCCCGACACGGCCCTGCCCTCGTGCGAGCCCGACGACGACCTAGCCCTCTCC
TTCTCCGCCCCGTCCGCAGCCTCCGGGCTCAACACGCCCCTCTACGTCCGCGCCGACTCGCTCCCGGCCTCGAGC
CTGCCCGCCCGGCTGCAGACGCACGCGTCCTCCCTCGTCTCCGTCGAGTACGCTTCTTCCGTCGCCTCGTCGTCC
CCCTGCGCCTCGGCCTACGCCGAACTCTCCCTCGAGAGCGACAGAGGAGGTGAAGAGGGTGGCCCTGTCCCGACC
TCGGCCAGAAGCCAGTCCCCCTTCCGAGTCTCGAGACGGGCTGTCATGAACGGCGATGCCGAGCTGCATCGTCGT
TCCTCCTCGCCGCTCAAACGACGTGCCTCAGGCATGGATCCCGAAACAAAGACCGGCAATAACGGCCCCGACGCA
GAAATGGCCAAGTCTCAGCCTACAAATCGTGTCGACGATTCTTCCGTACCCACCACCACCAGTCTTCCTCGCGCC
ATGAGCATCGACCCGCCGGAGCCCAACGGCTACGATGCAGAAGCAGCCGTATCGTCTCAATGTATGTTGCACGCG
TCCCAAAACTCTCCGATCACCACCGTCCCTACCGACCTCTCCCCAATATCACATGCAAATGACTGACACGGAACC
AGCTCCCCCTCCGCTCCTGGAGCAAGTCAAGATCATCGAGATGCTGTTGAAAGCCTTTGCCGAAGCGCCCGTCAA
GGAGGGCTGCCTGGCATATCTCGTCTCGCGATCGTGGGTGAACCAGGCCCTGGCCCTGCGTACGGACTCCAAATC
GTCCGTGGCCGATTCCGGAGACGCCTCGTTGGGCCCCATTGACAACTCCGACATCATCGACGAGGTCGTCCGCGA
CTCGACCGGCCAAAGCTTCGTCCGCCTGAAGCCCGGCTCCGGGCTCGAGTCCTTCGAGCTGTTCCCCGAGGACGC
TTGGAAGCTCGTGATGGACTGGTACGGAATCAAGCAGGGCCAGGACCCCATCGTGCGCGTCGCCGTCAACACCGC
CAACAGCAAACAAGACCCGCCCAACATCATGTTCGAGTTCCATCCGCCCGTCTTCAGCGTCTACCGGCTCTGGTC
CCAGGTCAGCCCGCTGCCGATAGAGCAGTCGCTCAAGGCCAGGAATCCGCCGCCGCTCGTCTTCGCCAGGAGCTC
CACCGCGCACGCCCAGACGTTTCTCAGGGAGCTCAAGACTCAGGCCGGCATTCCCTTGGAACGCAAGGTTCGACT
GTTCATGGTCCCTCCGACCGTGGAACTGGCCCCGGCCAGTCACCCCACGGAGCTGCAGCCTGCCGCCCTCACGCC
GCCCGACTCTCCCGGAGCCCAGGGAGCCAATCAGCCGCAGCACGCCTGGCGCAACCTCCTCCTCGACATCGCCAG
CTTTTCTCAAGTCCGCGACTCGAGGGTCTTGGTCACCCTGGCGGACAGCACGGCGAATGAGAAATTCAACGGCCA
GACGTCCCTCCAGCACTACAACCTGACAACCGACCAGATACTCGTCCTCGACGAGGCCATCGGCGCGTACTGGGT
CAGCAAATACACGGGACAGGAGAAGGTGGCGGAAAAGTCGATACCGTCGAGGGCCGGCATCGCCGCCCCCTTCTC
CTCATCCAAGTCCAACAGCAACAGGAGCAGCCCGGCCCGCGACGGCCCGCTCACCCGCGGGCGGGCCCAAAAGAA
GCGGCTCGGCCGGCGCACAGGGGCCGTCGGCCTGCACAACCTGGGAAACACGTGCTACATGAACTCCGCCTTGCA
GTGTGTCCGCAGCGTGGAAGAACTGACCAAATACTTCTTGACGGAATCCCACCTCCCCGAGATCAACGACACCAA
CGTCCTGGGCTACGAAGGCAGAGTGGCGATAGCGTACGGCAACCTCCTCAGGGAGATACACGAGGAAGGGAGAAC
GGCCGTGAGCCCGCGCGACTTCAAGGCCACCGTCGGCCGCTGCCGCCCCACCTTCTCGGGATGGGGCCAGCAGGA
CTCCCAGGAGTTCCTGGGATTCCTGCTCGATGCCCTGCAGGAGGACCTGAGCCGCATCAAGAAGAAGCCGTACAT
CGAAAAGCCCGATTCCACGGACGACATGATCAACAATCCGGAGGCGATCCGGGAGATGGCAGACAAGGTGTGGGA
CATCACGCGCCGACGGGACGACTCCGTCATCGCCGATCTCTTCACCGGCATGTACAAGTCGACGCTCAAGTGCCC
CGAGTGCGGCAAGATCAGCATCACCTTCGACCCGTTCAACAACCTGACCCTGCCGCTGCCGTTGGAGAACATGTG
GTCCAGGCCCGTCAAGTTCTTCCCGCTGAACGACGTGCCGGTCAAGATCGACGTGGAGCTGTCCAAGCACAGCTC
CATGGAGAGTCTCAAGCAGTTCATCTCGGACCGGACCGGCGTTCCCACCGACCGGCTGATGGGGGCCGAGGAGTT
CAAGGATCGCTTCTTCAAGATCTACGACAACAGCCAAGACGTCTCGGACGAGATCCAGCAGTCGGACACGCCGAC
AATGCATGAGCTGGAGGCCCCCCCGACGAACTGGCCGGGCAAGGCTCCGCGGAAGAAGTACCGCTCCATGCTCGA
CGTCGACTCGCCCCTGGATTCCGTCGAGCCGGACGACGAGCAGTGCGCCACCATGGTCGTCCCTGTCCTCCATCG
CCGTCCCCAGATGCTCGGGCGGGGGCTCGAGGGAGTCTCGCCTCCCCATTTCATCACATTGAGCAGAAAGGAGGC
ATTCAGTCTGGACGCCATACAGCGCAAGGTGCTCGAGAAGGTGGCCACCTTCTCCACCTGGTCCAGGCTCTCCGA
CGCCTCCACTCACGAGAACGGGAGCGCGGACTCGACCGAGGGCGACATGGTCATCGCCACGGCCTCGGATGCCGA
TTCTTCCGGAGACAGCAAGGTCGCCGCCCGCTCGGTGGTGGGCGAGGACGACATGGTCGACATCACGATGAAGGA
CGCGCACGCCCGGCCCGGCTCGAAGCCGACCCCGCTGAAGCGCTTCAACACGCGCCGACCCGCGTTTGCCAACCC
GGACAGCTTCCTCGACCCGGATCTCCAGAACCTCTTCGAGCTGTGCTACTTCCGGAGTGATTCGGACGGCCTCGT
GCCGACCGGGTGGTCCAGCGTCGACAACACCTGCCCGTTGCCCAAGCTGTCCGACCGCGTTCCCGACGTCAAGGA
GACGGACCAGGCCAGCCCGGGCAGCGTGAGCAGCACGGTCTCGGGCAACGACGACAGCAGCAACGAGGACGAGGT
CGGACCGGACACGCCCCAGACGCGCATGACGGAAGAGTCGAGCGACGAAGACGCCTCCCCGGCTGCCAGGGTACA
GTTGCCAGTCGGCGCGTCGAAGCTTGAGCACATCAGACTGACATTGGCCCAGTTCGCAGTTCGCCCCGGTCGTCG
GGACCAGAAGTTCGGAGCCGGCGGGCGCAAGAAGTTCAAGAGCCACAGGACGTACGGTAAGAAGGGTAACAAGCG
CCGTGACAAGCAGGTGCGGGCCGGCAAGAACTCGCACCGCGCGCCTCCGGCCGCCGTGAGCCCGCAGCCAATGCC
CCCGGCCGTGGCGGACGGGGGGCCGCTCGTCCGGCTCTACGAGGGCATCGTCGTCGACTGGAACGAGGATGCCTG
GGAGACGGTCTTCGGCAACATGTCGAGACGCTACGACGCGGCGCAGGGAGCCCGGACGTTTACGGATCCCGAGTC
GCTCCATGACCCGGCCCTCAAGATGAACCAGAAAAAGAGGCAGACGCGGAAGACTAGAGGCATCACGCTGGAAGA
GTGCCTGGACGAGTTCGAGCGCGCCGAGGTGCTGTCGGAGCAAGACATGTGGTACTGCCCACGGTGCAAGGAGCA
CCGACGGGCAAGCAAGAAGTTCGACCTGTGGAAGACACCTGACATCCTCGTCGCCCACCTCAAGCGATTTAGCAA
CTCCGGGTGGCGCCGAGAGAAGCTGGATGTCCTCGTCGACTTCCCCATCGAAAACCTGGACCTCACGTCGAGGGT
GATACAAAAGGAGGACGGCAAAGTCGAGGTCTACGACCTGATCGGCGTCGACGACCACTACGGAGGCCTCGGCGG
CGGCCACTACACCGCCTACGCCAAGAACTTCGTCGACAGGCGGTGGTACAGCTTCAACGGTAAGTGGAAGCGTCG
GAACCCCCCCCCCCCCCCCTTTTCCTTTTTGACCGCATGGCTGTCGTGGATGGCCGAGCCAGATGACTGACGCCG
GGCCAGACTCTTCGGTACATGTCGTGTCGGACCCCACATCCATCGTCACGAGCGCCGCGTACCTGCTCTTCTACC
GCAGACGCTCCAGCGGCCCCCTGGGAGGACCGCGATTCGCGGAGATCCTGGACAAGTACGACAGGGAGAATGGCC
TGTCTGACGAGGAAAACGCAGAGTCGGGCGAAGACGGGCGGGCGCCGGCAAGAGGCGCCGGCAGGCAGACTGTCA
AGCCAGACGAGGACGAGCTCCCGCCCTACGACGAGACGATCCGCCGGAGCATCGAAGGCGACGGAGAGGAGACGT
CGGACGGGTACCACGAGCTAGGGTCGAAATCGCTGGATATGACGCAGGGTTGGAACTTCAACGGGCTGGACAGCC
GAGGGGGCGAAGGATCGACGGGGGGCGATTGCGGCAGCGACGACGCCCAGTTCGACTCATCGGGCGATGACCGAG
CCCGTGACTTCTTCGAGCAGGACACGGACATGGCGTCGAGCGCGGCGGTTGAGGAAAGTGCGGGCTGGGAGGGCC
AGGGGGTCATTGCGGTGCCGGCGCGAGCCGGCAGCGAAGGCGACTCGGACGAAGTGACGGAGATTCACCTCGAGG
GCGACAAGGCAGGTCGCCGGCAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail