Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10176
Gene name
LocationContig_8:55968..58585
Strand+
Gene length (bp)2617
Transcript length (bp)2475
Coding sequence length (bp)2475
Protein length (aa) 825

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00082 Peptidase_S8 Subtilase family 3.8E-36 169 432
PF01483 P_proprotein Proprotein convertase P-domain 6.5E-24 507 593

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P09231|KEX1A_KLULA Protease KEX1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=KEX1 PE=3 SV=2 102 728 0.0E+00
sp|Q09175|KRP1_SCHPO Dibasic-processing endoprotease OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=krp1 PE=1 SV=1 19 709 2.0E-174
sp|O13359|KEX2_CANAW Kexin OS=Candida albicans (strain WO-1) GN=KEX2 PE=3 SV=2 94 603 1.0E-169
sp|P13134|KEX2_YEAST Kexin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEX2 PE=1 SV=1 109 625 4.0E-166
sp|P42781|XPR6_YARLI Dibasic-processing endoprotease OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=XPR6 PE=3 SV=1 134 602 3.0E-157
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P09231|KEX1A_KLULA Protease KEX1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=KEX1 PE=3 SV=2 102 728 0.0E+00
sp|Q09175|KRP1_SCHPO Dibasic-processing endoprotease OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=krp1 PE=1 SV=1 19 709 2.0E-174
sp|O13359|KEX2_CANAW Kexin OS=Candida albicans (strain WO-1) GN=KEX2 PE=3 SV=2 94 603 1.0E-169
sp|P13134|KEX2_YEAST Kexin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEX2 PE=1 SV=1 109 625 4.0E-166
sp|P42781|XPR6_YARLI Dibasic-processing endoprotease OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=XPR6 PE=3 SV=1 134 602 3.0E-157
sp|P23377|FURIN_RAT Furin OS=Rattus norvegicus GN=Furin PE=1 SV=1 138 605 2.0E-118
sp|P23188|FURIN_MOUSE Furin OS=Mus musculus GN=Furin PE=1 SV=2 138 605 6.0E-118
sp|Q6UW60|PCSK4_HUMAN Proprotein convertase subtilisin/kexin type 4 OS=Homo sapiens GN=PCSK4 PE=2 SV=2 138 627 8.0E-117
sp|P09958|FURIN_HUMAN Furin OS=Homo sapiens GN=FURIN PE=1 SV=2 95 609 2.0E-116
sp|P29119|FURI1_XENLA Furin-1 OS=Xenopus laevis GN=furin PE=2 SV=1 95 597 3.0E-116
sp|Q61139|PCSK7_MOUSE Proprotein convertase subtilisin/kexin type 7 OS=Mus musculus GN=Pcsk7 PE=2 SV=2 48 595 2.0E-115
sp|Q78EH2|PCSK4_RAT Proprotein convertase subtilisin/kexin type 4 OS=Rattus norvegicus GN=Pcsk4 PE=2 SV=1 69 599 2.0E-115
sp|Q28193|FURIN_BOVIN Furin OS=Bos taurus GN=FURIN PE=1 SV=1 95 609 7.0E-115
sp|Q62849|PCSK7_RAT Proprotein convertase subtilisin/kexin type 7 OS=Rattus norvegicus GN=Pcsk7 PE=1 SV=1 48 621 1.0E-114
sp|Q16549|PCSK7_HUMAN Proprotein convertase subtilisin/kexin type 7 OS=Homo sapiens GN=PCSK7 PE=1 SV=2 132 600 7.0E-114
sp|P29121|PCSK4_MOUSE Proprotein convertase subtilisin/kexin type 4 OS=Mus musculus GN=Pcsk4 PE=2 SV=1 69 572 1.0E-112
sp|P21661|NEC2_MOUSE Neuroendocrine convertase 2 OS=Mus musculus GN=Pcsk2 PE=1 SV=1 134 595 2.0E-110
sp|P28841|NEC2_RAT Neuroendocrine convertase 2 OS=Rattus norvegicus GN=Pcsk2 PE=1 SV=1 134 595 3.0E-110
sp|P16519|NEC2_HUMAN Neuroendocrine convertase 2 OS=Homo sapiens GN=PCSK2 PE=2 SV=2 134 595 4.0E-109
sp|Q5REC2|NEC2_PONAB Neuroendocrine convertase 2 OS=Pongo abelii GN=PCSK2 PE=2 SV=1 134 595 5.0E-109
sp|P29145|NECB_HYDVU PC3-like endoprotease variant B OS=Hydra vulgaris PE=2 SV=1 48 576 8.0E-109
sp|Q03333|NEC2_PIG Neuroendocrine convertase 2 OS=Sus scrofa GN=PCSK2 PE=2 SV=1 134 595 2.0E-108
sp|Q9GLR0|NEC2_BOVIN Neuroendocrine convertase 2 OS=Bos taurus GN=PCSK2 PE=2 SV=1 88 595 2.0E-108
sp|P51559|BLI4_CAEEL Endoprotease bli-4 OS=Caenorhabditis elegans GN=bli-4 PE=2 SV=2 61 606 6.0E-108
sp|P29146|NECA_HYDVU PC3-like endoprotease variant A OS=Hydra vulgaris PE=2 SV=1 48 576 7.0E-108
sp|P29122|PCSK6_HUMAN Proprotein convertase subtilisin/kexin type 6 OS=Homo sapiens GN=PCSK6 PE=1 SV=1 132 597 8.0E-107
sp|Q63415|PCSK6_RAT Proprotein convertase subtilisin/kexin type 6 OS=Rattus norvegicus GN=Pcsk6 PE=2 SV=1 133 597 2.0E-106
sp|P30432|FUR2_DROME Furin-like protease 2 OS=Drosophila melanogaster GN=Fur2 PE=2 SV=2 64 597 2.0E-106
sp|P28840|NEC1_RAT Neuroendocrine convertase 1 OS=Rattus norvegicus GN=Pcsk1 PE=2 SV=1 34 595 3.0E-106
sp|Q9GLR1|NEC1_BOVIN Neuroendocrine convertase 1 OS=Bos taurus GN=PCSK1 PE=2 SV=1 34 595 1.0E-104
sp|P63240|NEC1_MUSCO Neuroendocrine convertase 1 OS=Mus cookii GN=Pcsk1 PE=2 SV=1 34 595 1.0E-104
sp|P63239|NEC1_MOUSE Neuroendocrine convertase 1 OS=Mus musculus GN=Pcsk1 PE=1 SV=1 34 595 2.0E-104
sp|P29120|NEC1_HUMAN Neuroendocrine convertase 1 OS=Homo sapiens GN=PCSK1 PE=1 SV=2 34 595 2.0E-104
sp|Q92824|PCSK5_HUMAN Proprotein convertase subtilisin/kexin type 5 OS=Homo sapiens GN=PCSK5 PE=1 SV=4 132 598 8.0E-101
sp|P26016|FUR11_DROME Furin-like protease 1, isoforms 1/1-X/2 OS=Drosophila melanogaster GN=Fur1 PE=2 SV=2 51 609 2.0E-100
sp|Q04592|PCSK5_MOUSE Proprotein convertase subtilisin/kexin type 5 OS=Mus musculus GN=Pcsk5 PE=1 SV=3 132 598 2.0E-100
sp|P41413|PCSK5_RAT Proprotein convertase subtilisin/kexin type 5 OS=Rattus norvegicus GN=Pcsk5 PE=2 SV=3 132 598 2.0E-100
sp|P30430|FUR1C_DROME Furin-like protease 1, isoform 1-CRR OS=Drosophila melanogaster GN=Fur1 PE=2 SV=2 84 601 4.0E-99
sp|O17798|FKPC1_CAEEL Furin-like protease kpc-1 OS=Caenorhabditis elegans GN=kpc-1 PE=1 SV=2 73 467 2.0E-89
sp|Q9NJ15|PCSK5_BRACL Proprotein convertase subtilisin/kexin type 5 OS=Branchiostoma californiense GN=PC6 PE=2 SV=1 132 597 8.0E-89
sp|P23916|PRCA_ANAVT Calcium-dependent protease OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=prcA PE=1 SV=3 141 576 1.0E-31
sp|Q59149|PRCA_NOSS1 Calcium-dependent protease OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=prcA PE=3 SV=2 141 576 5.0E-30
sp|P42780|BPRX_DICNO Extracellular subtilisin-like protease OS=Dichelobacter nodosus PE=3 SV=1 138 402 3.0E-15
sp|P23314|EXPR_XANCP Extracellular protease OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=XCC0851 PE=3 SV=1 119 421 2.0E-11
sp|P42779|BPRV_DICNO Extracellular basic protease OS=Dichelobacter nodosus GN=bprV PE=1 SV=1 138 593 5.0E-10
sp|Q00139|VG47_ICHVA Subtilisin-like protease OS=Ictalurid herpesvirus 1 (strain Auburn) GN=ORF47 PE=3 SV=2 270 572 7.0E-10
sp|P35835|SUBN_BACNA Subtilisin NAT OS=Bacillus subtilis subsp. natto GN=aprN PE=1 SV=1 156 456 5.0E-09
sp|P07518|SUBT_BACPU Subtilisin OS=Bacillus pumilus GN=apr PE=1 SV=1 156 456 8.0E-09
sp|P04189|SUBT_BACSU Subtilisin E OS=Bacillus subtilis (strain 168) GN=aprE PE=1 SV=3 156 456 1.0E-08
sp|O17798|FKPC1_CAEEL Furin-like protease kpc-1 OS=Caenorhabditis elegans GN=kpc-1 PE=1 SV=2 501 595 9.0E-08
sp|I3R794|HLY_HALMT Halolysin OS=Haloferax mediterranei (strain ATCC 33500 / DSM 1411 / JCM 8866 / NBRC 14739 / NCIMB 2177 / R-4) GN=hly PE=1 SV=1 125 424 4.0E-07
sp|P00782|SUBT_BACAM Subtilisin BPN' OS=Bacillus amyloliquefaciens GN=apr PE=1 SV=1 156 248 5.0E-07
sp|P29139|ISP_PAEPO Intracellular serine protease OS=Paenibacillus polymyxa GN=isp PE=1 SV=1 144 413 6.0E-07
sp|Q99405|PRTM_BACSK M-protease OS=Bacillus clausii (strain KSM-K16) GN=aprE PE=1 SV=2 166 453 7.0E-07
sp|P20724|ELYA_BACYA Alkaline elastase YaB OS=Bacillus sp. (strain YaB) GN=ale PE=1 SV=1 166 414 8.0E-07
sp|Q9RYM8|SUB2_DEIRA Probable subtilase-type serine protease DR_A0283 OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=DR_A0283 PE=1 SV=1 28 276 1.0E-06
sp|P29599|SUBB_BACLE Subtilisin BL OS=Bacillus lentus PE=1 SV=1 165 414 1.0E-06
sp|P29142|SUBT_GEOSE Subtilisin J OS=Geobacillus stearothermophilus GN=aprJ PE=3 SV=1 156 456 1.0E-06
sp|P00783|SUBT_BACSA Subtilisin amylosacchariticus OS=Bacillus subtilis subsp. amylosacchariticus GN=apr PE=1 SV=2 156 456 1.0E-06
sp|P27693|ELYA_BACAO Alkaline protease OS=Bacillus alcalophilus PE=1 SV=1 166 414 3.0E-06
sp|P41362|ELYA_BACCS Alkaline protease OS=Bacillus clausii PE=1 SV=1 166 414 4.0E-06
sp|P11018|ISP1_BACSU Major intracellular serine protease OS=Bacillus subtilis (strain 168) GN=isp PE=1 SV=2 157 400 5.0E-06
sp|P00781|SUBD_BACLI Subtilisin DY OS=Bacillus licheniformis GN=apr PE=1 SV=1 165 456 7.0E-06
sp|P29141|SUBV_BACSU Minor extracellular protease vpr OS=Bacillus subtilis (strain 168) GN=vpr PE=1 SV=1 46 251 7.0E-06
sp|P29600|SUBS_BACLE Subtilisin Savinase OS=Bacillus lentus PE=1 SV=1 166 414 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004252 serine-type endopeptidase activity Yes
GO:0006508 proteolysis Yes
GO:0008152 metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0017171 serine hydrolase activity No
GO:1901564 organonitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0043170 macromolecule metabolic process No
GO:0019538 protein metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0008236 serine-type peptidase activity No
GO:0070011 peptidase activity, acting on L-amino acid peptides No
GO:0071704 organic substance metabolic process No
GO:0004175 endopeptidase activity No
GO:0003824 catalytic activity No
GO:0008233 peptidase activity No
GO:0044238 primary metabolic process No
GO:0016787 hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 687 709 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10176
MDAASSARRPAPRDDCEGDSYVLEIAPGVSPRHVADRLGIRYLEALPLHGHHLFCARKADYDIVEYEIHELRRKR
DAGAVDILDNVLLSDKQQLRQRVKRTIPPLQHTDLRSRKPLGAPVPQAVNAQTTLMQTLNIYDPIFRDQWHLFNT
ISPGHDVNATGLWLEGITGSNVTVAIIDDGLDMYSDDLKANYFADGSYDFNSNKSEPKPQLSDDKHGTRCAGEVA
AVRNNVCGVGVAYDARVAGIRILSGPISDADESKAMLYQNQHNQIYSCSWGPPDDGRSMDAPGILIRRAILEGIQ
QGRGGLGSLFVFASGNGAASGDNCNFDGYTNSIFSITVGAVDRVGEHPYYSELCSAQLVVTYSSGHADHIHTTDV
GTNACTTTHGGTSAAAPLAAGIFALAMQVRPDLTWRDFQYLAMDTALPVSAQADSWQTTAIGKRFSHYFGYGKID
SYALVQKAKSWVKVKPQAWLFSPWVHVRAGIPEGSHGLITSLEITDEMMRKENLARIEHVTVTMFVNHTRRGDLS
VDLISPARVVSHIATARPQDDHNGGYDGWTFMSVVHWGELGVGTWNLVVRDVNVNAHNGTLIDWRLKLWGEAIDA
KKAYPLPMPNTTDDNDHDRITSTVTGPVETSPLGPPGELPTSISLPTDHPERPTKPGPLPTSSAPGAAPTGPGVP
PGFSPGKPGPIWIYGAFCLIIVFCIALGSWLWIARRRRLRNQARDNYEFELIDEEELEALEGGEKDGGGGRKGRR
TRGGELYDAFAGGSDDEDDAVDKYRDQSSERLVGSDEAEAEAEQYVVGEETDDGDDNSVAGDQADARLLERDRR*
Coding >Hirsu2|10176
ATGGACGCCGCATCCTCCGCCCGACGGCCCGCTCCCCGAGACGACTGCGAAGGCGACTCCTATGTTCTCGAGATA
GCCCCAGGCGTCTCGCCACGCCATGTCGCCGACCGTCTCGGCATTCGATACCTCGAGGCTCTGCCGCTCCACGGC
CATCATCTTTTTTGCGCCCGCAAAGCCGACTACGACATCGTCGAATATGAGATACACGAGTTGCGCCGGAAGCGA
GACGCCGGAGCGGTCGACATCCTCGACAATGTCCTGCTGTCAGACAAGCAGCAGCTGCGGCAGCGGGTGAAGCGC
ACGATCCCGCCTCTCCAACATACCGACTTGCGTTCCCGGAAGCCCCTTGGCGCTCCTGTGCCCCAAGCCGTCAAC
GCCCAGACCACCCTCATGCAAACGCTCAACATATACGACCCCATATTCCGAGACCAGTGGCACCTCTTCAACACC
ATCTCTCCTGGTCACGATGTCAACGCCACGGGCCTTTGGCTCGAGGGTATCACGGGCTCAAACGTCACCGTCGCT
ATCATCGACGATGGCCTTGACATGTACAGCGACGACCTCAAGGCCAACTATTTCGCTGACGGCTCGTACGACTTT
AACAGCAACAAGTCGGAGCCCAAGCCTCAGCTGTCCGATGATAAGCATGGCACCCGCTGTGCCGGCGAGGTTGCC
GCCGTTCGTAACAACGTGTGCGGAGTGGGCGTGGCCTACGACGCGCGCGTGGCCGGCATCCGCATTCTCAGCGGG
CCCATCAGCGACGCCGACGAGTCCAAGGCCATGCTCTACCAGAACCAGCATAACCAAATCTACTCGTGCTCTTGG
GGTCCTCCCGACGATGGCCGATCCATGGACGCCCCCGGCATCCTCATCCGAAGAGCCATCCTCGAAGGCATCCAA
CAAGGCCGCGGCGGCCTGGGCTCTCTCTTCGTCTTCGCCAGCGGCAATGGAGCCGCCAGCGGGGACAACTGCAAT
TTTGACGGATACACAAACTCCATTTTCAGCATCACCGTCGGGGCCGTCGACCGCGTCGGCGAGCATCCCTACTAC
TCGGAACTTTGTTCCGCCCAGCTCGTCGTCACCTACAGCAGCGGTCACGCCGATCACATCCACACGACGGATGTT
GGCACCAACGCATGCACAACGACGCACGGCGGCACCTCTGCTGCTGCCCCCCTCGCCGCTGGCATCTTCGCACTT
GCCATGCAAGTCCGGCCAGATCTGACGTGGAGAGACTTCCAGTACCTGGCAATGGATACGGCCCTTCCCGTCAGT
GCCCAAGCCGACAGCTGGCAGACGACGGCCATCGGCAAGAGGTTTAGCCACTACTTTGGATACGGCAAGATCGAC
AGCTACGCTCTCGTGCAAAAGGCCAAGTCGTGGGTCAAGGTCAAACCCCAGGCCTGGCTTTTCTCGCCCTGGGTG
CACGTCAGAGCGGGCATTCCCGAGGGCTCTCACGGCCTCATCACCTCCCTCGAAATAACCGACGAAATGATGAGG
AAGGAAAACCTGGCTCGCATCGAGCATGTGACGGTCACCATGTTTGTCAACCACACTCGACGCGGCGACCTGAGC
GTCGACCTTATCAGCCCGGCCAGGGTGGTCAGCCATATTGCGACGGCTCGACCCCAAGACGATCACAACGGCGGC
TACGACGGCTGGACTTTCATGAGCGTCGTTCACTGGGGCGAACTCGGCGTCGGCACCTGGAATCTGGTTGTGCGC
GACGTCAACGTCAACGCGCATAACGGCACCCTAATCGACTGGCGCCTGAAGCTCTGGGGAGAGGCCATCGACGCC
AAGAAGGCCTACCCGCTCCCCATGCCCAACACGACCGACGACAACGACCACGACAGGATCACATCGACGGTGACC
GGGCCCGTCGAAACGTCGCCACTGGGACCGCCTGGCGAGTTGCCCACGAGCATCAGCCTTCCGACAGATCATCCA
GAGCGACCGACGAAACCCGGCCCGTTGCCCACCAGCTCCGCGCCGGGCGCAGCGCCCACCGGCCCCGGCGTGCCG
CCTGGCTTCTCGCCGGGCAAGCCAGGTCCCATCTGGATCTACGGCGCATTCTGCCTCATCATCGTCTTCTGCATC
GCCCTGGGCTCGTGGCTCTGGATTGCCCGACGCCGTCGGCTGAGAAACCAGGCCCGTGACAACTACGAATTCGAG
CTCATCGACGAGGAGGAGCTGGAGGCCCTGGAGGGCGGAGAAAAGGACGGCGGTGGCGGAAGAAAGGGACGACGA
ACCCGGGGCGGAGAGCTGTACGATGCCTTTGCCGGCGGGAGCGACGATGAAGACGACGCCGTGGACAAGTACAGG
GATCAGTCGTCGGAGAGACTGGTGGGGTCGGATGAGGCCGAGGCCGAGGCCGAGCAGTACGTGGTGGGCGAGGAG
ACGGACGACGGTGACGACAACAGCGTGGCGGGCGACCAGGCAGACGCGAGACTCCTGGAGCGCGATCGCAGGTGA
Transcript >Hirsu2|10176
ATGGACGCCGCATCCTCCGCCCGACGGCCCGCTCCCCGAGACGACTGCGAAGGCGACTCCTATGTTCTCGAGATA
GCCCCAGGCGTCTCGCCACGCCATGTCGCCGACCGTCTCGGCATTCGATACCTCGAGGCTCTGCCGCTCCACGGC
CATCATCTTTTTTGCGCCCGCAAAGCCGACTACGACATCGTCGAATATGAGATACACGAGTTGCGCCGGAAGCGA
GACGCCGGAGCGGTCGACATCCTCGACAATGTCCTGCTGTCAGACAAGCAGCAGCTGCGGCAGCGGGTGAAGCGC
ACGATCCCGCCTCTCCAACATACCGACTTGCGTTCCCGGAAGCCCCTTGGCGCTCCTGTGCCCCAAGCCGTCAAC
GCCCAGACCACCCTCATGCAAACGCTCAACATATACGACCCCATATTCCGAGACCAGTGGCACCTCTTCAACACC
ATCTCTCCTGGTCACGATGTCAACGCCACGGGCCTTTGGCTCGAGGGTATCACGGGCTCAAACGTCACCGTCGCT
ATCATCGACGATGGCCTTGACATGTACAGCGACGACCTCAAGGCCAACTATTTCGCTGACGGCTCGTACGACTTT
AACAGCAACAAGTCGGAGCCCAAGCCTCAGCTGTCCGATGATAAGCATGGCACCCGCTGTGCCGGCGAGGTTGCC
GCCGTTCGTAACAACGTGTGCGGAGTGGGCGTGGCCTACGACGCGCGCGTGGCCGGCATCCGCATTCTCAGCGGG
CCCATCAGCGACGCCGACGAGTCCAAGGCCATGCTCTACCAGAACCAGCATAACCAAATCTACTCGTGCTCTTGG
GGTCCTCCCGACGATGGCCGATCCATGGACGCCCCCGGCATCCTCATCCGAAGAGCCATCCTCGAAGGCATCCAA
CAAGGCCGCGGCGGCCTGGGCTCTCTCTTCGTCTTCGCCAGCGGCAATGGAGCCGCCAGCGGGGACAACTGCAAT
TTTGACGGATACACAAACTCCATTTTCAGCATCACCGTCGGGGCCGTCGACCGCGTCGGCGAGCATCCCTACTAC
TCGGAACTTTGTTCCGCCCAGCTCGTCGTCACCTACAGCAGCGGTCACGCCGATCACATCCACACGACGGATGTT
GGCACCAACGCATGCACAACGACGCACGGCGGCACCTCTGCTGCTGCCCCCCTCGCCGCTGGCATCTTCGCACTT
GCCATGCAAGTCCGGCCAGATCTGACGTGGAGAGACTTCCAGTACCTGGCAATGGATACGGCCCTTCCCGTCAGT
GCCCAAGCCGACAGCTGGCAGACGACGGCCATCGGCAAGAGGTTTAGCCACTACTTTGGATACGGCAAGATCGAC
AGCTACGCTCTCGTGCAAAAGGCCAAGTCGTGGGTCAAGGTCAAACCCCAGGCCTGGCTTTTCTCGCCCTGGGTG
CACGTCAGAGCGGGCATTCCCGAGGGCTCTCACGGCCTCATCACCTCCCTCGAAATAACCGACGAAATGATGAGG
AAGGAAAACCTGGCTCGCATCGAGCATGTGACGGTCACCATGTTTGTCAACCACACTCGACGCGGCGACCTGAGC
GTCGACCTTATCAGCCCGGCCAGGGTGGTCAGCCATATTGCGACGGCTCGACCCCAAGACGATCACAACGGCGGC
TACGACGGCTGGACTTTCATGAGCGTCGTTCACTGGGGCGAACTCGGCGTCGGCACCTGGAATCTGGTTGTGCGC
GACGTCAACGTCAACGCGCATAACGGCACCCTAATCGACTGGCGCCTGAAGCTCTGGGGAGAGGCCATCGACGCC
AAGAAGGCCTACCCGCTCCCCATGCCCAACACGACCGACGACAACGACCACGACAGGATCACATCGACGGTGACC
GGGCCCGTCGAAACGTCGCCACTGGGACCGCCTGGCGAGTTGCCCACGAGCATCAGCCTTCCGACAGATCATCCA
GAGCGACCGACGAAACCCGGCCCGTTGCCCACCAGCTCCGCGCCGGGCGCAGCGCCCACCGGCCCCGGCGTGCCG
CCTGGCTTCTCGCCGGGCAAGCCAGGTCCCATCTGGATCTACGGCGCATTCTGCCTCATCATCGTCTTCTGCATC
GCCCTGGGCTCGTGGCTCTGGATTGCCCGACGCCGTCGGCTGAGAAACCAGGCCCGTGACAACTACGAATTCGAG
CTCATCGACGAGGAGGAGCTGGAGGCCCTGGAGGGCGGAGAAAAGGACGGCGGTGGCGGAAGAAAGGGACGACGA
ACCCGGGGCGGAGAGCTGTACGATGCCTTTGCCGGCGGGAGCGACGATGAAGACGACGCCGTGGACAAGTACAGG
GATCAGTCGTCGGAGAGACTGGTGGGGTCGGATGAGGCCGAGGCCGAGGCCGAGCAGTACGTGGTGGGCGAGGAG
ACGGACGACGGTGACGACAACAGCGTGGCGGGCGACCAGGCAGACGCGAGACTCCTGGAGCGCGATCGCAGGTGA
Gene >Hirsu2|10176
ATGGACGCCGCATCCTCCGCCCGACGGCCCGCTCCCCGAGACGACTGCGAAGGCGACTCCTATGTTCTCGAGATA
GCCCCAGGCGTCTCGCCACGCCATGTCGCCGACCGTCTCGGCATTCGATACCTCGAGGCTCTGCCGCTCCACGGC
CATCATCTTTTTTGCGCCCGCAAAGCCGACTACGACATCGTCGAATATGAGATACACGAGTTGCGCCGGAAGCGA
GACGCCGGAGCGGTCGACATCCTCGACAATGTCCTGCTGTCAGACAAGCAGCAGCTGCGGCAGCGGGTGAAGCGC
ACGATCCCGCCTCTCCAACATACCGACTTGCGTTCCCGGAAGCCCCTTGGCGCTCCTGTGCCCCAAGCCGTCAAC
GCCCAGACCACCCTCATGCAAACGCTCAACATATACGACCCCATATTCCGAGACCAGTGGCACCTCTTCAACACC
ATCTCTCCTGGTCACGATGTCAACGCCACGGGCCTTTGGCTCGAGGGTATCACGGGCTCAAACGTCACCGTCGCT
ATCATCGACGATGGCCTTGACATGTACAGCGACGACCTCAAGGCCAACTATTTCGCTGACGGCTCGTACGACTTT
AACAGCAACAAGTCGGAGCCCAAGCCTCAGCTGTCCGATGATAAGCATGGCACCCGCTGTGCCGGCGAGGTTGCC
GCCGTTCGTAACAACGTGTGCGGAGTGGGCGTGGCCTACGACGCGCGCGTGGCCGGCATCCGCATTCTCAGCGGG
CCCATCAGCGACGCCGACGAGTCCAAGGCCATGCTCTACCAGAACCAGCATAACCAAATCTACTCGTGCTCTTGG
GGTCCTCCCGACGATGGCCGATCCATGGACGCCCCCGGCATCCTCATCCGAAGAGCCATCCTCGAAGGCATCCAA
CAAGGCCGCGGCGGCCTGGGCTCTCTCTTCGTCTTCGCCAGCGGCAATGGAGCCGCCAGCGGGGACAACTGCAAT
TTTGACGGATACACAAACTCCATTTTCAGCATCACCGTCGGGGCCGTCGACCGCGTCGGCGAGCATCCCTACTAC
TCGGAACTTTGTTCCGCCCAGCTCGTCGTCACCTACAGCAGCGGTCACGCCGATCACATCGTGGGTCCCCCTTCA
TTGCGTCGGTCCTCGTTCTCGTGCCATGGCCACGGGCTAGGCTAACCCACCGCAGCACACGACGGATGTTGGCAC
CAACGCATGCACAACGACGCACGGCGGCACCTCTGCTGCTGCCCCCCTCGCCGCTGGCATCTTCGCACTTGCCAT
GCAAGTCCGGCCAGATCTGACGTGGAGAGACTTCCAGTACCTGGCAATGGATACGGCCCTTCCCGTCAGTGCCCA
AGCCGACAGCTGGCAGACGACGGCCATCGGCAAGAGGTTTAGCCACTACTTTGGATACGGCAAGATCGACAGCTA
CGCTCTCGTGCAAAAGGCCAAGTCGTGGGTCAAGGTCAAACCCCAGGCCTGGCTTTTCTCGCCCTGGGTGCACGT
CAGAGCGGGCATTCCCGAGGGCTCTCACGGCCTCATCACCTCCCTCGAAATAACCGACGAAATGATGAGGAAGGA
AAACCTGGCTCGCATCGAGCATGTGACGGTCACCATGTTTGTCAACCACACTCGACGCGGCGACCTGAGCGTCGA
CCTTATCAGCCCGGCCAGGGTGGTCAGCCATATTGCGACGGCTCGACCCCAAGACGATCACAACGGCGGCTACGA
CGGCTGGACTTTCATGAGCGTCGTTCACTGGTAGGTCGAGCATTGAAGCATGGAGACGCTCCTCTAGAGAGTACA
GGATCACTGATGACGCAAAACACCCAGGGGCGAACTCGGCGTCGGCACCTGGAATCTGGTTGTGCGCGACGTCAA
CGTCAACGCGCATAACGGCACCCTAATCGACTGGCGCCTGAAGCTCTGGGGAGAGGCCATCGACGCCAAGAAGGC
CTACCCGCTCCCCATGCCCAACACGACCGACGACAACGACCACGACAGGATCACATCGACGGTGACCGGGCCCGT
CGAAACGTCGCCACTGGGACCGCCTGGCGAGTTGCCCACGAGCATCAGCCTTCCGACAGATCATCCAGAGCGACC
GACGAAACCCGGCCCGTTGCCCACCAGCTCCGCGCCGGGCGCAGCGCCCACCGGCCCCGGCGTGCCGCCTGGCTT
CTCGCCGGGCAAGCCAGGTCCCATCTGGATCTACGGCGCATTCTGCCTCATCATCGTCTTCTGCATCGCCCTGGG
CTCGTGGCTCTGGATTGCCCGACGCCGTCGGCTGAGAAACCAGGCCCGTGACAACTACGAATTCGAGCTCATCGA
CGAGGAGGAGCTGGAGGCCCTGGAGGGCGGAGAAAAGGACGGCGGTGGCGGAAGAAAGGGACGACGAACCCGGGG
CGGAGAGCTGTACGATGCCTTTGCCGGCGGGAGCGACGATGAAGACGACGCCGTGGACAAGTACAGGGATCAGTC
GTCGGAGAGACTGGTGGGGTCGGATGAGGCCGAGGCCGAGGCCGAGCAGTACGTGGTGGGCGAGGAGACGGACGA
CGGTGACGACAACAGCGTGGCGGGCGACCAGGCAGACGCGAGACTCCTGGAGCGCGATCGCAGGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail