Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10167
Gene name
LocationContig_8:31977..32767
Strand-
Gene length (bp)790
Transcript length (bp)729
Coding sequence length (bp)729
Protein length (aa) 243

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00857 Isochorismatase Isochorismatase family 1.1E-26 15 219

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9USS0|PNC1_SCHPO Nicotinamidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pnc1 PE=3 SV=2 10 230 4.0E-33
sp|P53184|PNC1_YEAST Nicotinamidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PNC1 PE=1 SV=1 15 200 2.0E-30
sp|P21369|PNCA_ECOLI Pyrazinamidase/nicotinamidase OS=Escherichia coli (strain K12) GN=pncA PE=3 SV=1 15 210 5.0E-28

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 56 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10167
MADAHDDGAVPFTPALLVVDFQEDFCPPHGALAVPQGRSIASIVNLLLTLPFALRLATRDWHPPDHISFSASHPG
LRNGSTAAVVHPHDPSRRYDTLLWPTHCVAGSPGAALVPELRADCLDGVVDKGTDRRLEMYSAFYDPFRLVETGL
AERLRAEAVTHVFVVGLAADFCVAATAEHARDEGFATYVVREATRPVYPDAWPASVQHVFDKGVRLVSVDGPEVA
RVRALSRPSCPAPTPRD*
Coding >Hirsu2|10167
ATGGCAGACGCTCACGACGACGGCGCCGTGCCCTTCACGCCCGCGCTCCTCGTCGTCGACTTCCAAGAAGACTTT
TGTCCACCGCACGGAGCGCTGGCAGTGCCTCAGGGGCGCTCCATCGCCTCCATCGTCAACCTGCTGCTCACGCTG
CCGTTCGCGCTGCGGCTGGCAACGCGCGACTGGCACCCGCCCGACCACATCTCCTTCTCCGCCAGCCACCCGGGC
TTGCGCAACGGCAGCACGGCGGCGGTGGTGCACCCGCACGACCCGTCGCGCCGCTACGACACGCTGCTGTGGCCG
ACGCACTGCGTTGCCGGCTCGCCCGGCGCGGCGCTCGTGCCGGAGCTGCGCGCCGACTGCCTCGACGGCGTCGTC
GACAAGGGCACTGACCGCCGGCTGGAGATGTACTCGGCGTTTTATGACCCCTTTCGGCTGGTTGAGACGGGGCTT
GCGGAGCGGCTGCGCGCCGAGGCTGTGACGCATGTTTTTGTTGTTGGGCTGGCGGCTGACTTTTGCGTTGCTGCT
ACGGCTGAGCATGCCCGCGATGAGGGCTTCGCTACTTACGTCGTTCGCGAGGCTACCCGGCCTGTCTATCCCGAT
GCTTGGCCCGCCTCTGTCCAGCACGTCTTCGACAAGGGCGTTCGCCTCGTCTCCGTCGACGGGCCCGAGGTTGCC
AGGGTCCGGGCCCTGTCTCGCCCGTCCTGTCCGGCGCCGACCCCCCGAGACTAG
Transcript >Hirsu2|10167
ATGGCAGACGCTCACGACGACGGCGCCGTGCCCTTCACGCCCGCGCTCCTCGTCGTCGACTTCCAAGAAGACTTT
TGTCCACCGCACGGAGCGCTGGCAGTGCCTCAGGGGCGCTCCATCGCCTCCATCGTCAACCTGCTGCTCACGCTG
CCGTTCGCGCTGCGGCTGGCAACGCGCGACTGGCACCCGCCCGACCACATCTCCTTCTCCGCCAGCCACCCGGGC
TTGCGCAACGGCAGCACGGCGGCGGTGGTGCACCCGCACGACCCGTCGCGCCGCTACGACACGCTGCTGTGGCCG
ACGCACTGCGTTGCCGGCTCGCCCGGCGCGGCGCTCGTGCCGGAGCTGCGCGCCGACTGCCTCGACGGCGTCGTC
GACAAGGGCACTGACCGCCGGCTGGAGATGTACTCGGCGTTTTATGACCCCTTTCGGCTGGTTGAGACGGGGCTT
GCGGAGCGGCTGCGCGCCGAGGCTGTGACGCATGTTTTTGTTGTTGGGCTGGCGGCTGACTTTTGCGTTGCTGCT
ACGGCTGAGCATGCCCGCGATGAGGGCTTCGCTACTTACGTCGTTCGCGAGGCTACCCGGCCTGTCTATCCCGAT
GCTTGGCCCGCCTCTGTCCAGCACGTCTTCGACAAGGGCGTTCGCCTCGTCTCCGTCGACGGGCCCGAGGTTGCC
AGGGTCCGGGCCCTGTCTCGCCCGTCCTGTCCGGCGCCGACCCCCCGAGACTAG
Gene >Hirsu2|10167
ATGGCAGACGCTCACGACGACGGCGCCGTGCCCTTCACGCCCGCGCTCCTCGTCGTCGACTTCCAAGAAGACTTT
TGTCCACCGGTACGCCCCTCGCTCCTCTCCCTCCCCCCCGCCCGGCTCCAGCTGAAGAACAAACGGCCAGCACGG
AGCGCTGGCAGTGCCTCAGGGGCGCTCCATCGCCTCCATCGTCAACCTGCTGCTCACGCTGCCGTTCGCGCTGCG
GCTGGCAACGCGCGACTGGCACCCGCCCGACCACATCTCCTTCTCCGCCAGCCACCCGGGCTTGCGCAACGGCAG
CACGGCGGCGGTGGTGCACCCGCACGACCCGTCGCGCCGCTACGACACGCTGCTGTGGCCGACGCACTGCGTTGC
CGGCTCGCCCGGCGCGGCGCTCGTGCCGGAGCTGCGCGCCGACTGCCTCGACGGCGTCGTCGACAAGGGCACTGA
CCGCCGGCTGGAGATGTACTCGGCGTTTTATGACCCCTTTCGGCTGGTTGAGACGGGGCTTGCGGAGCGGCTGCG
CGCCGAGGCTGTGACGCATGTTTTTGTTGTTGGGCTGGCGGCTGACTTTTGCGTTGCTGCTACGGCTGAGCATGC
CCGCGATGAGGGCTTCGCTACTTACGTCGTTCGCGAGGCTACCCGGCCTGTCTATCCCGATGCTTGGCCCGCCTC
TGTCCAGCACGTCTTCGACAAGGGCGTTCGCCTCGTCTCCGTCGACGGGCCCGAGGTTGCCAGGGTCCGGGCCCT
GTCTCGCCCGTCCTGTCCGGCGCCGACCCCCCGAGACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail