Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10155
Gene name
LocationContig_799:4004..6608
Strand-
Gene length (bp)2604
Transcript length (bp)2487
Coding sequence length (bp)2487
Protein length (aa) 829

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01302 CAP_GLY CAP-Gly domain 6.5E-14 120 187
PF16641 CLIP1_ZNF CLIP1 zinc knuckle 1.5E-03 807 822

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P79065|TIP1_SCHPO Tip elongation protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tip1 PE=1 SV=1 120 187 2.0E-09
sp|P11709|BIK1_YEAST Nuclear fusion protein BIK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BIK1 PE=1 SV=1 120 189 2.0E-08
sp|P34531|YM92_CAEEL Uncharacterized protein M01A8.2 OS=Caenorhabditis elegans GN=M01A8.2 PE=3 SV=4 120 188 5.0E-08
sp|P49454|CENPF_HUMAN Centromere protein F OS=Homo sapiens GN=CENPF PE=1 SV=2 348 650 5.0E-08
sp|P30622|CLIP1_HUMAN CAP-Gly domain-containing linker protein 1 OS=Homo sapiens GN=CLIP1 PE=1 SV=2 96 230 7.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P79065|TIP1_SCHPO Tip elongation protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tip1 PE=1 SV=1 120 187 2.0E-09
sp|P11709|BIK1_YEAST Nuclear fusion protein BIK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BIK1 PE=1 SV=1 120 189 2.0E-08
sp|P34531|YM92_CAEEL Uncharacterized protein M01A8.2 OS=Caenorhabditis elegans GN=M01A8.2 PE=3 SV=4 120 188 5.0E-08
sp|P49454|CENPF_HUMAN Centromere protein F OS=Homo sapiens GN=CENPF PE=1 SV=2 348 650 5.0E-08
sp|P30622|CLIP1_HUMAN CAP-Gly domain-containing linker protein 1 OS=Homo sapiens GN=CLIP1 PE=1 SV=2 96 230 7.0E-08
sp|P35458|DCTN1_CHICK Dynactin subunit 1 OS=Gallus gallus GN=DCTN1 PE=1 SV=2 118 585 3.0E-07
sp|Q922J3|CLIP1_MOUSE CAP-Gly domain-containing linker protein 1 OS=Mus musculus GN=Clip1 PE=1 SV=1 99 192 5.0E-07
sp|O42184|CLIP1_CHICK CAP-Gly domain-containing linker protein 1 OS=Gallus gallus GN=CLIP1 PE=2 SV=1 63 215 5.0E-07
sp|P30622|CLIP1_HUMAN CAP-Gly domain-containing linker protein 1 OS=Homo sapiens GN=CLIP1 PE=1 SV=2 99 192 7.0E-07
sp|O42184|CLIP1_CHICK CAP-Gly domain-containing linker protein 1 OS=Gallus gallus GN=CLIP1 PE=2 SV=1 115 200 7.0E-07
sp|Q922J3|CLIP1_MOUSE CAP-Gly domain-containing linker protein 1 OS=Mus musculus GN=Clip1 PE=1 SV=1 106 237 1.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10155
MAPTATATATTSTTTTTTTSSASPAAPAAFHSGRPAFSRSLRKPASSASTPDLGSAYAAQSRLVPPGLSRKASLV
ALTSSSLASIPDVSESYALDSVLSDSSYAMPPATPARPAADDVAVGEAVDVPGGMHGTLRFLGSVQGKKGLFAGV
ELHADFLARGKNSGDVDGVSYFTTTTPGAGIFVPVPKIARRGTANGSSTASFPITPTPNGPAALRNGNGHSTSLT
PPTPALHKLSASLGPGARAPSPHLKRPRTSLPRPDSPLRRAQMTPGPRPSIGTPAKVPSRYGSPTNRFAQSVRGT
AGDPSKKPARLDRKPSIGPRSASALGTTPAFDDDPSHVGLQRSKTNGSAGSISSLNMKMHRPASRALAVNDDEID
RLRSQLEDRDRQLKEQATTLAEMESSLVELQSLIEHPDGPRFRRNSLDDKDSAQLRHMLREKNDKIAMLTAEFDA
HRADFRSTIDTLELASAETERVYEKRIEELVAELRELEHRNLDVDTVASQLKQLEELVQELEEGLEDARRGEAEA
RGEAEFLRGEVERTRSELRREREKGGSGANAQGDVVTSSKELEQKEDEIRGLKAIIHSLSRDPMPAGDGRGPAQR
PSSLGGSAGADLVQGKIARDNLERQVAELQTLLERRTAREEELELELDALRGSGHGPQGHPLPAQRSTQRDSRDT
VIPVRTHGSRTPDATHKRGNTLDTMHESDTVSTATETSTLWCEICETSGHDILTCTNMFGPDSGKNGGEAKTGRD
GPKPAPVAVKGDGAEPAPLSPVKPRLAASTTPVKIMPNPMESGPVAGKESGVVDPEKWCAVCERDGHDSVDCPFE
DAF*
Coding >Hirsu2|10155
ATGGCTCCCACCGCCACCGCGACCGCCACCACCTCCACCACCACCACCACCACCACCTCCTCCGCCAGCCCAGCA
GCGCCCGCCGCCTTCCACAGCGGCCGCCCGGCCTTCTCCCGCTCGCTGCGCAAGCCTGCCTCCTCGGCCTCGACC
CCCGACCTGGGCTCCGCCTACGCCGCCCAGTCGAGGCTCGTCCCGCCCGGCCTGTCGCGCAAGGCCTCGCTCGTC
GCCCTCACCTCCAGCTCGCTCGCCAGCATCCCCGATGTCAGCGAGAGCTACGCCCTCGACTCCGTCCTGAGCGAC
TCGTCCTACGCCATGCCCCCTGCCACCCCCGCCAGGCCCGCCGCCGACGACGTCGCCGTCGGCGAGGCCGTCGAC
GTCCCGGGCGGCATGCACGGCACCCTGCGCTTCCTCGGCTCCGTCCAGGGCAAGAAGGGCCTCTTTGCCGGCGTC
GAGCTGCACGCCGACTTCCTGGCACGTGGCAAGAACAGCGGTGACGTCGACGGAGTCTCCTACTTCACCACCACG
ACGCCCGGCGCCGGCATCTTCGTCCCCGTGCCCAAGATCGCTCGCCGGGGGACTGCCAATGGCTCCTCCACCGCC
AGCTTCCCCATCACGCCCACGCCCAACGGCCCGGCCGCCCTGAGGAACGGAAACGGCCATTCGACGAGCCTCACG
CCCCCGACGCCCGCCCTGCACAAGCTCAGCGCCTCGCTCGGCCCCGGTGCCCGCGCCCCCAGCCCGCATCTCAAG
CGGCCGCGGACCTCGCTGCCCCGTCCCGATTCCCCCCTCCGCCGCGCCCAGATGACGCCCGGGCCGAGGCCCTCC
ATCGGGACCCCGGCCAAGGTGCCTTCGCGATACGGCAGCCCGACCAACAGGTTCGCCCAGAGCGTCCGCGGCACC
GCCGGCGACCCCAGCAAGAAGCCGGCCAGGCTCGACCGCAAGCCCAGCATCGGCCCCCGCAGCGCCTCGGCACTG
GGCACCACGCCCGCCTTCGACGACGATCCGTCCCATGTCGGCCTGCAGCGATCCAAGACCAACGGTAGTGCCGGG
TCCATCTCGTCGCTCAACATGAAGATGCATCGTCCCGCCTCGCGCGCACTGGCCGTCAACGACGACGAGATCGAC
CGTCTGCGCTCCCAGCTCGAGGACCGCGACCGCCAGCTCAAGGAGCAGGCCACCACGCTGGCCGAGATGGAGAGC
AGCCTCGTCGAGCTGCAGTCCCTCATCGAGCACCCGGACGGGCCCCGGTTCCGGAGGAACAGCCTGGACGACAAG
GACTCGGCCCAGCTCCGCCACATGCTGCGGGAGAAGAACGACAAGATCGCCATGCTCACCGCAGAGTTCGACGCC
CACCGGGCCGACTTCCGGAGTACTATCGACACCCTCGAGCTGGCCAGCGCCGAGACGGAGCGCGTGTACGAGAAG
CGGATCGAGGAGCTCGTGGCCGAGCTGCGGGAGCTGGAGCACAGGAACCTGGACGTGGACACGGTGGCGAGCCAG
CTGAAGCAGCTCGAGGAGCTGGTCCAGGAGCTCGAGGAGGGCCTCGAGGACGCCCGCCGCGGCGAGGCCGAGGCC
CGCGGCGAGGCCGAGTTCCTGCGCGGCGAGGTGGAGAGGACCCGGTCGGAGCTCCGGCGCGAGCGCGAAAAGGGC
GGCTCCGGCGCCAACGCCCAGGGCGACGTCGTCACCTCGTCCAAGGAGCTGGAGCAGAAGGAGGACGAGATCAGG
GGCCTCAAGGCCATCATCCACTCGCTCAGCCGCGACCCGATGCCGGCAGGCGACGGCCGGGGCCCCGCCCAACGG
CCGAGCTCGCTGGGCGGCTCCGCCGGCGCCGACTTGGTACAGGGCAAGATTGCCCGCGACAACCTGGAGAGGCAG
GTGGCCGAGCTGCAGACGCTCCTGGAGAGGAGGACGGCCCGGGAGGAGGAGCTGGAGCTGGAGCTCGACGCGCTA
CGGGGCAGCGGCCACGGTCCGCAGGGACACCCGCTGCCGGCGCAGCGGTCGACGCAGAGAGACTCGCGCGACACG
GTGATACCGGTCCGCACGCACGGGTCGCGGACGCCCGACGCGACGCACAAGAGGGGCAACACGCTCGACACGATG
CACGAGAGCGACACGGTGTCGACGGCGACGGAGACTAGCACGCTCTGGTGCGAGATCTGCGAGACGAGCGGGCAC
GACATCCTGACCTGCACCAACATGTTCGGTCCCGACAGCGGCAAGAACGGAGGCGAGGCCAAGACGGGCCGCGAC
GGGCCGAAGCCGGCGCCGGTGGCCGTCAAGGGCGACGGCGCCGAGCCGGCGCCGCTGTCGCCCGTCAAGCCTCGG
CTGGCGGCGTCGACGACGCCGGTCAAGATCATGCCGAACCCGATGGAGTCTGGCCCGGTGGCGGGCAAGGAGAGC
GGCGTGGTGGACCCGGAGAAGTGGTGCGCGGTATGCGAGCGGGACGGCCACGACAGCGTCGACTGCCCGTTCGAG
GACGCGTTCTAG
Transcript >Hirsu2|10155
ATGGCTCCCACCGCCACCGCGACCGCCACCACCTCCACCACCACCACCACCACCACCTCCTCCGCCAGCCCAGCA
GCGCCCGCCGCCTTCCACAGCGGCCGCCCGGCCTTCTCCCGCTCGCTGCGCAAGCCTGCCTCCTCGGCCTCGACC
CCCGACCTGGGCTCCGCCTACGCCGCCCAGTCGAGGCTCGTCCCGCCCGGCCTGTCGCGCAAGGCCTCGCTCGTC
GCCCTCACCTCCAGCTCGCTCGCCAGCATCCCCGATGTCAGCGAGAGCTACGCCCTCGACTCCGTCCTGAGCGAC
TCGTCCTACGCCATGCCCCCTGCCACCCCCGCCAGGCCCGCCGCCGACGACGTCGCCGTCGGCGAGGCCGTCGAC
GTCCCGGGCGGCATGCACGGCACCCTGCGCTTCCTCGGCTCCGTCCAGGGCAAGAAGGGCCTCTTTGCCGGCGTC
GAGCTGCACGCCGACTTCCTGGCACGTGGCAAGAACAGCGGTGACGTCGACGGAGTCTCCTACTTCACCACCACG
ACGCCCGGCGCCGGCATCTTCGTCCCCGTGCCCAAGATCGCTCGCCGGGGGACTGCCAATGGCTCCTCCACCGCC
AGCTTCCCCATCACGCCCACGCCCAACGGCCCGGCCGCCCTGAGGAACGGAAACGGCCATTCGACGAGCCTCACG
CCCCCGACGCCCGCCCTGCACAAGCTCAGCGCCTCGCTCGGCCCCGGTGCCCGCGCCCCCAGCCCGCATCTCAAG
CGGCCGCGGACCTCGCTGCCCCGTCCCGATTCCCCCCTCCGCCGCGCCCAGATGACGCCCGGGCCGAGGCCCTCC
ATCGGGACCCCGGCCAAGGTGCCTTCGCGATACGGCAGCCCGACCAACAGGTTCGCCCAGAGCGTCCGCGGCACC
GCCGGCGACCCCAGCAAGAAGCCGGCCAGGCTCGACCGCAAGCCCAGCATCGGCCCCCGCAGCGCCTCGGCACTG
GGCACCACGCCCGCCTTCGACGACGATCCGTCCCATGTCGGCCTGCAGCGATCCAAGACCAACGGTAGTGCCGGG
TCCATCTCGTCGCTCAACATGAAGATGCATCGTCCCGCCTCGCGCGCACTGGCCGTCAACGACGACGAGATCGAC
CGTCTGCGCTCCCAGCTCGAGGACCGCGACCGCCAGCTCAAGGAGCAGGCCACCACGCTGGCCGAGATGGAGAGC
AGCCTCGTCGAGCTGCAGTCCCTCATCGAGCACCCGGACGGGCCCCGGTTCCGGAGGAACAGCCTGGACGACAAG
GACTCGGCCCAGCTCCGCCACATGCTGCGGGAGAAGAACGACAAGATCGCCATGCTCACCGCAGAGTTCGACGCC
CACCGGGCCGACTTCCGGAGTACTATCGACACCCTCGAGCTGGCCAGCGCCGAGACGGAGCGCGTGTACGAGAAG
CGGATCGAGGAGCTCGTGGCCGAGCTGCGGGAGCTGGAGCACAGGAACCTGGACGTGGACACGGTGGCGAGCCAG
CTGAAGCAGCTCGAGGAGCTGGTCCAGGAGCTCGAGGAGGGCCTCGAGGACGCCCGCCGCGGCGAGGCCGAGGCC
CGCGGCGAGGCCGAGTTCCTGCGCGGCGAGGTGGAGAGGACCCGGTCGGAGCTCCGGCGCGAGCGCGAAAAGGGC
GGCTCCGGCGCCAACGCCCAGGGCGACGTCGTCACCTCGTCCAAGGAGCTGGAGCAGAAGGAGGACGAGATCAGG
GGCCTCAAGGCCATCATCCACTCGCTCAGCCGCGACCCGATGCCGGCAGGCGACGGCCGGGGCCCCGCCCAACGG
CCGAGCTCGCTGGGCGGCTCCGCCGGCGCCGACTTGGTACAGGGCAAGATTGCCCGCGACAACCTGGAGAGGCAG
GTGGCCGAGCTGCAGACGCTCCTGGAGAGGAGGACGGCCCGGGAGGAGGAGCTGGAGCTGGAGCTCGACGCGCTA
CGGGGCAGCGGCCACGGTCCGCAGGGACACCCGCTGCCGGCGCAGCGGTCGACGCAGAGAGACTCGCGCGACACG
GTGATACCGGTCCGCACGCACGGGTCGCGGACGCCCGACGCGACGCACAAGAGGGGCAACACGCTCGACACGATG
CACGAGAGCGACACGGTGTCGACGGCGACGGAGACTAGCACGCTCTGGTGCGAGATCTGCGAGACGAGCGGGCAC
GACATCCTGACCTGCACCAACATGTTCGGTCCCGACAGCGGCAAGAACGGAGGCGAGGCCAAGACGGGCCGCGAC
GGGCCGAAGCCGGCGCCGGTGGCCGTCAAGGGCGACGGCGCCGAGCCGGCGCCGCTGTCGCCCGTCAAGCCTCGG
CTGGCGGCGTCGACGACGCCGGTCAAGATCATGCCGAACCCGATGGAGTCTGGCCCGGTGGCGGGCAAGGAGAGC
GGCGTGGTGGACCCGGAGAAGTGGTGCGCGGTATGCGAGCGGGACGGCCACGACAGCGTCGACTGCCCGTTCGAG
GACGCGTTCTAG
Gene >Hirsu2|10155
ATGGCTCCCACCGCCACCGCGACCGCCACCACCTCCACCACCACCACCACCACCACCTCCTCCGCCAGCCCAGCA
GCGCCCGCCGCCTTCCACAGCGGCCGCCCGGCCTTCTCCCGCTCGCTGCGCAAGCCTGCCTCCTCGGCCTCGACC
CCCGACCTGGGCTCCGCCTACGCCGCCCAGTCGAGGCTCGTCCCGCCCGGCCTGTCGCGCAAGGCCTCGCTCGTC
GCCCTCACCTCCAGCTCGCTCGCCAGCATCCCCGATGTCAGCGAGAGCTACGCCCTCGACTCCGTCCTGAGCGAC
TCGTCCTACGCCATGCCCCCTGCCACCCCCGCCAGGCCCGCCGCCGACGACGTCGCCGTCGGCGAGGCCGTCGAC
GTCCCGGGCGGCATGCACGGCACCCTGCGCTTCCTCGGCTCCGTCCAGGGCAAGAAGGGCCTCTTTGCCGGCGTC
GAGCTGCACGCCGACTTCCTGGCACGTGGCAAGAACAGCGGTGACGTCGACGGGTACGTCTGCTTCTCCCTGCGC
CCTGCGCCCTGCGCACCATCACCATCACCATCACCATCATGAATGTCTGCCTGTCTGTCTGTCCGGCCCCCGGCT
GACGCTCCACCGCCACGCAGAGTCTCCTACTTCACCACCACGACGCCCGGCGCCGGCATCTTCGTCCCCGTGCCC
AAGATCGCTCGCCGGGGGACTGCCAATGGCTCCTCCACCGCCAGCTTCCCCATCACGCCCACGCCCAACGGCCCG
GCCGCCCTGAGGAACGGAAACGGCCATTCGACGAGCCTCACGCCCCCGACGCCCGCCCTGCACAAGCTCAGCGCC
TCGCTCGGCCCCGGTGCCCGCGCCCCCAGCCCGCATCTCAAGCGGCCGCGGACCTCGCTGCCCCGTCCCGATTCC
CCCCTCCGCCGCGCCCAGATGACGCCCGGGCCGAGGCCCTCCATCGGGACCCCGGCCAAGGTGCCTTCGCGATAC
GGCAGCCCGACCAACAGGTTCGCCCAGAGCGTCCGCGGCACCGCCGGCGACCCCAGCAAGAAGCCGGCCAGGCTC
GACCGCAAGCCCAGCATCGGCCCCCGCAGCGCCTCGGCACTGGGCACCACGCCCGCCTTCGACGACGATCCGTCC
CATGTCGGCCTGCAGCGATCCAAGACCAACGGTAGTGCCGGGTCCATCTCGTCGCTCAACATGAAGATGCATCGT
CCCGCCTCGCGCGCACTGGCCGTCAACGACGACGAGATCGACCGTCTGCGCTCCCAGCTCGAGGACCGCGACCGC
CAGCTCAAGGAGCAGGCCACCACGCTGGCCGAGATGGAGAGCAGCCTCGTCGAGCTGCAGTCCCTCATCGAGCAC
CCGGACGGGCCCCGGTTCCGGAGGAACAGCCTGGACGACAAGGACTCGGCCCAGCTCCGCCACATGCTGCGGGAG
AAGAACGACAAGATCGCCATGCTCACCGCAGAGTTCGACGCCCACCGGGCCGACTTCCGGAGTACTATCGACACC
CTCGAGCTGGCCAGCGCCGAGACGGAGCGCGTGTACGAGAAGCGGATCGAGGAGCTCGTGGCCGAGCTGCGGGAG
CTGGAGCACAGGAACCTGGACGTGGACACGGTGGCGAGCCAGCTGAAGCAGCTCGAGGAGCTGGTCCAGGAGCTC
GAGGAGGGCCTCGAGGACGCCCGCCGCGGCGAGGCCGAGGCCCGCGGCGAGGCCGAGTTCCTGCGCGGCGAGGTG
GAGAGGACCCGGTCGGAGCTCCGGCGCGAGCGCGAAAAGGGCGGCTCCGGCGCCAACGCCCAGGGCGACGTCGTC
ACCTCGTCCAAGGAGCTGGAGCAGAAGGAGGACGAGATCAGGGGCCTCAAGGCCATCATCCACTCGCTCAGCCGC
GACCCGATGCCGGCAGGCGACGGCCGGGGCCCCGCCCAACGGCCGAGCTCGCTGGGCGGCTCCGCCGGCGCCGAC
TTGGTACAGGGCAAGATTGCCCGCGACAACCTGGAGAGGCAGGTGGCCGAGCTGCAGACGCTCCTGGAGAGGAGG
ACGGCCCGGGAGGAGGAGCTGGAGCTGGAGCTCGACGCGCTACGGGGCAGCGGCCACGGTCCGCAGGGACACCCG
CTGCCGGCGCAGCGGTCGACGCAGAGAGACTCGCGCGACACGGTGATACCGGTCCGCACGCACGGGTCGCGGACG
CCCGACGCGACGCACAAGAGGGGCAACACGCTCGACACGATGCACGAGAGCGACACGGTGTCGACGGCGACGGAG
ACTAGCACGCTCTGGTGCGAGATCTGCGAGACGAGCGGGCACGACATCCTGACCTGCACCAACATGTTCGGTCCC
GACAGCGGCAAGAACGGAGGCGAGGCCAAGACGGGCCGCGACGGGCCGAAGCCGGCGCCGGTGGCCGTCAAGGGC
GACGGCGCCGAGCCGGCGCCGCTGTCGCCCGTCAAGCCTCGGCTGGCGGCGTCGACGACGCCGGTCAAGATCATG
CCGAACCCGATGGAGTCTGGCCCGGTGGCGGGCAAGGAGAGCGGCGTGGTGGACCCGGAGAAGTGGTGCGCGGTA
TGCGAGCGGGACGGCCACGACAGCGTCGACTGCCCGTTCGAGGACGCGTTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail