Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10150
Gene name
LocationContig_797:10374..12183
Strand-
Gene length (bp)1809
Transcript length (bp)1809
Coding sequence length (bp)1809
Protein length (aa) 603

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03815 LCCL LCCL domain 2.1E-19 131 235

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P40514|YIG7_YEAST Uncharacterized protein YIL067C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIL067C PE=1 SV=1 13 602 4.0E-70

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 47 0.45

Transmembrane Domains

Domain # Start End Length
1 77 94 17
2 259 281 22
3 304 326 22
4 346 368 22
5 383 403 20
6 415 437 22
7 457 476 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10150
MGDDSDPPTPRFMQDEHAWKRWKWVPYPVRRTVKAVAKWSIGPANPQPYRIRPLFPTVQRFPLWLVDRFLPRRSY
RAWALFLYFSIWLVVFVLVKRKGNMATEVAGWGQPQTISCGSSYWGPGNACGLDGAQCRPFNDSGFAFRCSANCA
SYLVLNPRAVGDQEVVYQPLVVGGPSNDVRPDEATYRGDSYICAAAIHAGVITNQNGGCGVVNLVGKQQGFVSSQ
RNGVTSVGFDSYFPLSYQFLPGLTCSSEDSRWSLLALSVVFTAVLSLFTDSAALFFFPTFVGIFWTVGMALDPPP
QRTVTSLFSNILGKFLPAMFVAWVMYDRMGVRRTLKGLQAQVEKTVLWLGACWVGGMSNYTLDFIPIQRLNKHDL
DQQPGAKAALAIIVIVLVVIVATQVWFFRREGRLIKYLKLYALFLAAIVIGLVLPGLSLRIHHYIIGLVLLPGTS
LQTRPSLLYQGLLVGLFINGIARWGFDPVLQTPGALQGDAQRDTLLPTVHQPVISLAGANSGALSNITFSWDMPD
GSLYDGISVLVNDVERFRTYFGDVDEKPEFVWPRNSTSNLPEYFRFALMTGSDSGDYTKAGTWTADGRWRTMEPG
PS*
Coding >Hirsu2|10150
ATGGGCGACGACAGCGATCCCCCCACGCCGCGCTTCATGCAGGACGAACACGCCTGGAAGAGGTGGAAATGGGTT
CCCTATCCCGTCCGCCGCACCGTCAAGGCCGTCGCCAAGTGGTCCATCGGGCCTGCCAACCCCCAGCCGTATCGC
ATCCGACCGCTGTTCCCTACCGTCCAGCGCTTCCCGCTGTGGCTCGTCGACCGCTTCCTGCCCCGCCGCAGCTAC
CGCGCCTGGGCCCTCTTCCTCTACTTCTCCATATGGCTCGTCGTCTTCGTCCTCGTCAAGCGCAAGGGCAACATG
GCCACCGAGGTGGCCGGATGGGGCCAGCCGCAGACCATCAGCTGCGGCTCCTCGTACTGGGGCCCCGGCAACGCC
TGCGGCCTGGACGGCGCTCAGTGCCGCCCCTTTAACGACAGCGGCTTCGCCTTTCGCTGCTCCGCCAACTGCGCC
AGCTACCTGGTGCTGAATCCGAGGGCCGTCGGCGACCAGGAGGTCGTCTACCAGCCGCTCGTCGTCGGCGGGCCC
TCCAACGACGTCCGCCCGGACGAGGCCACCTACCGCGGCGACTCGTACATTTGCGCCGCCGCCATCCACGCCGGC
GTCATCACCAACCAGAACGGCGGCTGCGGCGTCGTCAACCTGGTCGGCAAGCAGCAGGGCTTCGTTAGTTCGCAG
AGGAACGGCGTCACGAGCGTCGGCTTCGACTCCTACTTCCCGCTCTCGTACCAGTTCCTCCCCGGCCTCACTTGC
TCCTCCGAGGACTCGCGCTGGTCCCTGCTTGCGCTGTCCGTCGTCTTCACCGCCGTCCTGTCGCTCTTCACCGAC
TCCGCCGCCCTCTTCTTCTTCCCCACCTTCGTCGGCATCTTCTGGACGGTCGGGATGGCGCTGGATCCGCCCCCG
CAGAGGACCGTCACCTCGCTCTTCTCCAACATCCTCGGCAAGTTCCTGCCAGCCATGTTCGTCGCGTGGGTCATG
TACGACAGGATGGGCGTGCGCCGCACGCTCAAGGGTCTTCAGGCCCAGGTGGAAAAGACGGTCCTGTGGCTGGGT
GCCTGCTGGGTCGGCGGCATGTCCAACTACACCCTGGACTTCATCCCCATCCAGCGGCTCAACAAGCACGACCTG
GACCAGCAGCCTGGCGCCAAGGCGGCGCTGGCCATCATCGTCATCGTTCTCGTCGTCATCGTCGCAACGCAAGTC
TGGTTCTTCCGACGCGAGGGCCGCCTCATCAAGTACCTCAAGCTCTACGCGCTGTTCCTCGCCGCCATCGTCATC
GGCCTCGTGCTTCCGGGCCTGAGCCTTCGGATCCACCATTACATCATCGGCCTCGTCCTGCTCCCGGGGACGAGC
CTGCAGACTCGGCCCTCGCTGCTGTACCAGGGTCTCCTCGTCGGTCTTTTCATCAACGGCATCGCCCGCTGGGGT
TTCGACCCCGTGCTGCAGACGCCGGGCGCGCTGCAGGGCGACGCGCAGCGCGATACCCTCCTGCCGACGGTCCAC
CAGCCCGTCATCAGCCTCGCTGGCGCCAACTCCGGCGCCCTCTCCAACATCACCTTCTCCTGGGACATGCCGGAC
GGCAGCCTCTACGACGGCATCAGCGTCCTCGTCAACGACGTGGAGCGCTTCCGCACCTACTTTGGCGACGTCGAC
GAGAAGCCCGAGTTCGTCTGGCCGCGTAACAGCACGTCGAACCTCCCGGAGTACTTCCGCTTCGCCCTCATGACC
GGCAGCGACAGCGGCGACTACACAAAGGCCGGCACGTGGACGGCCGACGGGAGGTGGAGGACCATGGAACCCGGC
CCGTCTTAG
Transcript >Hirsu2|10150
ATGGGCGACGACAGCGATCCCCCCACGCCGCGCTTCATGCAGGACGAACACGCCTGGAAGAGGTGGAAATGGGTT
CCCTATCCCGTCCGCCGCACCGTCAAGGCCGTCGCCAAGTGGTCCATCGGGCCTGCCAACCCCCAGCCGTATCGC
ATCCGACCGCTGTTCCCTACCGTCCAGCGCTTCCCGCTGTGGCTCGTCGACCGCTTCCTGCCCCGCCGCAGCTAC
CGCGCCTGGGCCCTCTTCCTCTACTTCTCCATATGGCTCGTCGTCTTCGTCCTCGTCAAGCGCAAGGGCAACATG
GCCACCGAGGTGGCCGGATGGGGCCAGCCGCAGACCATCAGCTGCGGCTCCTCGTACTGGGGCCCCGGCAACGCC
TGCGGCCTGGACGGCGCTCAGTGCCGCCCCTTTAACGACAGCGGCTTCGCCTTTCGCTGCTCCGCCAACTGCGCC
AGCTACCTGGTGCTGAATCCGAGGGCCGTCGGCGACCAGGAGGTCGTCTACCAGCCGCTCGTCGTCGGCGGGCCC
TCCAACGACGTCCGCCCGGACGAGGCCACCTACCGCGGCGACTCGTACATTTGCGCCGCCGCCATCCACGCCGGC
GTCATCACCAACCAGAACGGCGGCTGCGGCGTCGTCAACCTGGTCGGCAAGCAGCAGGGCTTCGTTAGTTCGCAG
AGGAACGGCGTCACGAGCGTCGGCTTCGACTCCTACTTCCCGCTCTCGTACCAGTTCCTCCCCGGCCTCACTTGC
TCCTCCGAGGACTCGCGCTGGTCCCTGCTTGCGCTGTCCGTCGTCTTCACCGCCGTCCTGTCGCTCTTCACCGAC
TCCGCCGCCCTCTTCTTCTTCCCCACCTTCGTCGGCATCTTCTGGACGGTCGGGATGGCGCTGGATCCGCCCCCG
CAGAGGACCGTCACCTCGCTCTTCTCCAACATCCTCGGCAAGTTCCTGCCAGCCATGTTCGTCGCGTGGGTCATG
TACGACAGGATGGGCGTGCGCCGCACGCTCAAGGGTCTTCAGGCCCAGGTGGAAAAGACGGTCCTGTGGCTGGGT
GCCTGCTGGGTCGGCGGCATGTCCAACTACACCCTGGACTTCATCCCCATCCAGCGGCTCAACAAGCACGACCTG
GACCAGCAGCCTGGCGCCAAGGCGGCGCTGGCCATCATCGTCATCGTTCTCGTCGTCATCGTCGCAACGCAAGTC
TGGTTCTTCCGACGCGAGGGCCGCCTCATCAAGTACCTCAAGCTCTACGCGCTGTTCCTCGCCGCCATCGTCATC
GGCCTCGTGCTTCCGGGCCTGAGCCTTCGGATCCACCATTACATCATCGGCCTCGTCCTGCTCCCGGGGACGAGC
CTGCAGACTCGGCCCTCGCTGCTGTACCAGGGTCTCCTCGTCGGTCTTTTCATCAACGGCATCGCCCGCTGGGGT
TTCGACCCCGTGCTGCAGACGCCGGGCGCGCTGCAGGGCGACGCGCAGCGCGATACCCTCCTGCCGACGGTCCAC
CAGCCCGTCATCAGCCTCGCTGGCGCCAACTCCGGCGCCCTCTCCAACATCACCTTCTCCTGGGACATGCCGGAC
GGCAGCCTCTACGACGGCATCAGCGTCCTCGTCAACGACGTGGAGCGCTTCCGCACCTACTTTGGCGACGTCGAC
GAGAAGCCCGAGTTCGTCTGGCCGCGTAACAGCACGTCGAACCTCCCGGAGTACTTCCGCTTCGCCCTCATGACC
GGCAGCGACAGCGGCGACTACACAAAGGCCGGCACGTGGACGGCCGACGGGAGGTGGAGGACCATGGAACCCGGC
CCGTCTTAG
Gene >Hirsu2|10150
ATGGGCGACGACAGCGATCCCCCCACGCCGCGCTTCATGCAGGACGAACACGCCTGGAAGAGGTGGAAATGGGTT
CCCTATCCCGTCCGCCGCACCGTCAAGGCCGTCGCCAAGTGGTCCATCGGGCCTGCCAACCCCCAGCCGTATCGC
ATCCGACCGCTGTTCCCTACCGTCCAGCGCTTCCCGCTGTGGCTCGTCGACCGCTTCCTGCCCCGCCGCAGCTAC
CGCGCCTGGGCCCTCTTCCTCTACTTCTCCATATGGCTCGTCGTCTTCGTCCTCGTCAAGCGCAAGGGCAACATG
GCCACCGAGGTGGCCGGATGGGGCCAGCCGCAGACCATCAGCTGCGGCTCCTCGTACTGGGGCCCCGGCAACGCC
TGCGGCCTGGACGGCGCTCAGTGCCGCCCCTTTAACGACAGCGGCTTCGCCTTTCGCTGCTCCGCCAACTGCGCC
AGCTACCTGGTGCTGAATCCGAGGGCCGTCGGCGACCAGGAGGTCGTCTACCAGCCGCTCGTCGTCGGCGGGCCC
TCCAACGACGTCCGCCCGGACGAGGCCACCTACCGCGGCGACTCGTACATTTGCGCCGCCGCCATCCACGCCGGC
GTCATCACCAACCAGAACGGCGGCTGCGGCGTCGTCAACCTGGTCGGCAAGCAGCAGGGCTTCGTTAGTTCGCAG
AGGAACGGCGTCACGAGCGTCGGCTTCGACTCCTACTTCCCGCTCTCGTACCAGTTCCTCCCCGGCCTCACTTGC
TCCTCCGAGGACTCGCGCTGGTCCCTGCTTGCGCTGTCCGTCGTCTTCACCGCCGTCCTGTCGCTCTTCACCGAC
TCCGCCGCCCTCTTCTTCTTCCCCACCTTCGTCGGCATCTTCTGGACGGTCGGGATGGCGCTGGATCCGCCCCCG
CAGAGGACCGTCACCTCGCTCTTCTCCAACATCCTCGGCAAGTTCCTGCCAGCCATGTTCGTCGCGTGGGTCATG
TACGACAGGATGGGCGTGCGCCGCACGCTCAAGGGTCTTCAGGCCCAGGTGGAAAAGACGGTCCTGTGGCTGGGT
GCCTGCTGGGTCGGCGGCATGTCCAACTACACCCTGGACTTCATCCCCATCCAGCGGCTCAACAAGCACGACCTG
GACCAGCAGCCTGGCGCCAAGGCGGCGCTGGCCATCATCGTCATCGTTCTCGTCGTCATCGTCGCAACGCAAGTC
TGGTTCTTCCGACGCGAGGGCCGCCTCATCAAGTACCTCAAGCTCTACGCGCTGTTCCTCGCCGCCATCGTCATC
GGCCTCGTGCTTCCGGGCCTGAGCCTTCGGATCCACCATTACATCATCGGCCTCGTCCTGCTCCCGGGGACGAGC
CTGCAGACTCGGCCCTCGCTGCTGTACCAGGGTCTCCTCGTCGGTCTTTTCATCAACGGCATCGCCCGCTGGGGT
TTCGACCCCGTGCTGCAGACGCCGGGCGCGCTGCAGGGCGACGCGCAGCGCGATACCCTCCTGCCGACGGTCCAC
CAGCCCGTCATCAGCCTCGCTGGCGCCAACTCCGGCGCCCTCTCCAACATCACCTTCTCCTGGGACATGCCGGAC
GGCAGCCTCTACGACGGCATCAGCGTCCTCGTCAACGACGTGGAGCGCTTCCGCACCTACTTTGGCGACGTCGAC
GAGAAGCCCGAGTTCGTCTGGCCGCGTAACAGCACGTCGAACCTCCCGGAGTACTTCCGCTTCGCCCTCATGACC
GGCAGCGACAGCGGCGACTACACAAAGGCCGGCACGTGGACGGCCGACGGGAGGTGGAGGACCATGGAACCCGGC
CCGTCTTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail