Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10145
Gene name
LocationContig_797:3077..4131
Strand+
Gene length (bp)1054
Transcript length (bp)999
Coding sequence length (bp)999
Protein length (aa) 333

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10357 Kin17_mid Domain of Kin17 curved DNA-binding protein 8.4E-53 52 177
PF12874 zf-met Zinc-finger of C2H2 type 3.2E-04 26 50

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7X9|KIN17_SCHPO KIN17-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC365.09c PE=3 SV=1 1 192 3.0E-78
sp|Q8K339|KIN17_MOUSE DNA/RNA-binding protein KIN17 OS=Mus musculus GN=Kin PE=1 SV=1 1 253 6.0E-66
sp|O60870|KIN17_HUMAN DNA/RNA-binding protein KIN17 OS=Homo sapiens GN=KIN PE=1 SV=2 1 205 3.0E-65
sp|Q55D16|KIN17_DICDI KIN17-like protein OS=Dictyostelium discoideum GN=DDB_G0269816 PE=3 SV=1 1 210 3.0E-51
sp|P40962|RTS2_YEAST Zinc finger protein RTS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RTS2 PE=1 SV=1 4 124 4.0E-32

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3212 0.8893 0.0318 0.0157 0.1163 0.0029 0.0463 0.0042 0.022 0.0018

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1113
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1835
Ophiocordyceps australis map64 (Brazil) OphauB2|7380
Ophiocordyceps camponoti-floridani Ophcf2|04791
Ophiocordyceps camponoti-rufipedis Ophun1|49
Ophiocordyceps kimflemingae Ophio5|826
Ophiocordyceps subramaniannii Hirsu2|10145 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10145
MPKAEVGSTKHLSNKLKSKGLQRLRWYCQVCEKQCRDANGFKMHTQSESHVRQMLVVGEDPKKFINEYSNQFLRD
FLQLLKTGHGEKQVHINQFYQEYIANKEHIHMNATKWPSLTEFAKYLGQESICRVEETEKGIHISWIDNSPEALQ
RQEALRRKEAQDQGDEQLEQRIIKEQIRRAQASATKRETNEEEDEEARNLKRNDGEKIKLSFGSKPKVQATESEA
TDASWQNSVAGSGASPNQSSVPSKEPAKASGFGGLTMKMTGKPQTKNVFAQAKKNALAAGTSKKAPAVDQPKKIS
EAERIMREEMERKRPRERAGFGQPPGKKPRNS*
Coding >Hirsu2|10145
ATGCCGAAGGCCGAGGTTGGCTCGACCAAGCATCTTTCCAACAAACTCAAAAGCAAAGGCCTCCAGCGCCTGCGA
TGGTACTGCCAGGTCTGCGAGAAGCAATGTCGAGACGCCAATGGATTTAAGATGCACACGCAGTCGGAAAGCCAC
GTGCGACAGATGCTGGTCGTCGGCGAGGATCCCAAGAAATTTATCAACGAATACAGCAACCAGTTCCTGAGGGAT
TTCCTGCAACTATTGAAGACGGGTCACGGCGAAAAGCAGGTGCACATCAACCAGTTCTACCAGGAATACATCGCC
AACAAGGAGCATATCCACATGAACGCCACAAAATGGCCCTCTTTAACTGAATTCGCCAAGTATCTAGGCCAAGAG
AGCATATGCCGAGTCGAAGAGACCGAGAAGGGAATCCATATTTCGTGGATCGACAACTCTCCAGAGGCGTTACAA
CGACAGGAAGCACTCCGCAGGAAGGAGGCGCAAGACCAGGGCGACGAGCAGCTGGAACAGCGCATCATCAAAGAG
CAGATCCGAAGAGCGCAGGCCAGCGCCACGAAACGCGAGACGAACGAAGAAGAGGACGAGGAGGCTCGGAACCTC
AAAAGGAACGATGGCGAGAAAATTAAATTGTCATTTGGCTCAAAACCGAAAGTACAGGCCACCGAGTCCGAGGCC
ACGGACGCCTCGTGGCAGAACTCGGTTGCTGGCTCAGGCGCGTCACCAAACCAGTCTTCAGTGCCCAGCAAGGAG
CCTGCGAAGGCCAGCGGCTTTGGCGGGCTCACCATGAAAATGACGGGCAAGCCGCAAACCAAAAATGTCTTTGCT
CAAGCAAAGAAAAACGCCTTGGCTGCTGGCACATCCAAGAAGGCTCCAGCAGTCGACCAGCCAAAGAAGATAAGC
GAAGCAGAGAGAATCATGAGGGAAGAAATGGAGCGGAAACGGCCACGAGAGCGTGCTGGGTTCGGCCAACCTCCC
GGAAAGAAGCCGAGGAACAGCTGA
Transcript >Hirsu2|10145
ATGCCGAAGGCCGAGGTTGGCTCGACCAAGCATCTTTCCAACAAACTCAAAAGCAAAGGCCTCCAGCGCCTGCGA
TGGTACTGCCAGGTCTGCGAGAAGCAATGTCGAGACGCCAATGGATTTAAGATGCACACGCAGTCGGAAAGCCAC
GTGCGACAGATGCTGGTCGTCGGCGAGGATCCCAAGAAATTTATCAACGAATACAGCAACCAGTTCCTGAGGGAT
TTCCTGCAACTATTGAAGACGGGTCACGGCGAAAAGCAGGTGCACATCAACCAGTTCTACCAGGAATACATCGCC
AACAAGGAGCATATCCACATGAACGCCACAAAATGGCCCTCTTTAACTGAATTCGCCAAGTATCTAGGCCAAGAG
AGCATATGCCGAGTCGAAGAGACCGAGAAGGGAATCCATATTTCGTGGATCGACAACTCTCCAGAGGCGTTACAA
CGACAGGAAGCACTCCGCAGGAAGGAGGCGCAAGACCAGGGCGACGAGCAGCTGGAACAGCGCATCATCAAAGAG
CAGATCCGAAGAGCGCAGGCCAGCGCCACGAAACGCGAGACGAACGAAGAAGAGGACGAGGAGGCTCGGAACCTC
AAAAGGAACGATGGCGAGAAAATTAAATTGTCATTTGGCTCAAAACCGAAAGTACAGGCCACCGAGTCCGAGGCC
ACGGACGCCTCGTGGCAGAACTCGGTTGCTGGCTCAGGCGCGTCACCAAACCAGTCTTCAGTGCCCAGCAAGGAG
CCTGCGAAGGCCAGCGGCTTTGGCGGGCTCACCATGAAAATGACGGGCAAGCCGCAAACCAAAAATGTCTTTGCT
CAAGCAAAGAAAAACGCCTTGGCTGCTGGCACATCCAAGAAGGCTCCAGCAGTCGACCAGCCAAAGAAGATAAGC
GAAGCAGAGAGAATCATGAGGGAAGAAATGGAGCGGAAACGGCCACGAGAGCGTGCTGGGTTCGGCCAACCTCCC
GGAAAGAAGCCGAGGAACAGCTGA
Gene >Hirsu2|10145
ATGCCGAAGGCCGAGGTTGGCTCGACCAAGCATCTTTCCAACAAACTCAAAAGCAAAGGCCTCCAGCGCCTGCGA
TGGTACTGCCAGGTCTGCGAGAAGCAATGTCGAGACGCCAATGGATTTAAGATGCACACGCAGTCGGAAAGCCAC
GTGCGACAGATGCTGGTCGTCGGCGAGGATCCCAAGAAATTTATCAACGAATACAGCAACCAGTTCCTGAGGGAT
TTCCTGCAACTATTGAAGACGGGTCACGGCGAAAAGCAGGTGCACATCAACCAGTTCTACCAGGAATACATCGCC
AACAAGGTGCGTGGGATTCCCGACTGCACGCCCATGCTTGTGGCCTACTGACAACGTGCAGGAGCATATCCACAT
GAACGCCACAAAATGGCCCTCTTTAACTGAATTCGCCAAGTATCTAGGCCAAGAGAGCATATGCCGAGTCGAAGA
GACCGAGAAGGGAATCCATATTTCGTGGATCGACAACTCTCCAGAGGCGTTACAACGACAGGAAGCACTCCGCAG
GAAGGAGGCGCAAGACCAGGGCGACGAGCAGCTGGAACAGCGCATCATCAAAGAGCAGATCCGAAGAGCGCAGGC
CAGCGCCACGAAACGCGAGACGAACGAAGAAGAGGACGAGGAGGCTCGGAACCTCAAAAGGAACGATGGCGAGAA
AATTAAATTGTCATTTGGCTCAAAACCGAAAGTACAGGCCACCGAGTCCGAGGCCACGGACGCCTCGTGGCAGAA
CTCGGTTGCTGGCTCAGGCGCGTCACCAAACCAGTCTTCAGTGCCCAGCAAGGAGCCTGCGAAGGCCAGCGGCTT
TGGCGGGCTCACCATGAAAATGACGGGCAAGCCGCAAACCAAAAATGTCTTTGCTCAAGCAAAGAAAAACGCCTT
GGCTGCTGGCACATCCAAGAAGGCTCCAGCAGTCGACCAGCCAAAGAAGATAAGCGAAGCAGAGAGAATCATGAG
GGAAGAAATGGAGCGGAAACGGCCACGAGAGCGTGCTGGGTTCGGCCAACCTCCCGGAAAGAAGCCGAGGAACAG
CTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail