Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10145
Gene name
LocationContig_797:3077..4131
Strand+
Gene length (bp)1054
Transcript length (bp)999
Coding sequence length (bp)999
Protein length (aa) 333

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10357 Kin17_mid Domain of Kin17 curved DNA-binding protein 2.2E-52 52 177
PF12874 zf-met Zinc-finger of C2H2 type 3.3E-04 26 50

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7X9|KIN17_SCHPO KIN17-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC365.09c PE=3 SV=1 1 192 3.0E-78
sp|Q8K339|KIN17_MOUSE DNA/RNA-binding protein KIN17 OS=Mus musculus GN=Kin PE=1 SV=1 1 253 6.0E-66
sp|O60870|KIN17_HUMAN DNA/RNA-binding protein KIN17 OS=Homo sapiens GN=KIN PE=1 SV=2 1 205 3.0E-65
sp|Q55D16|KIN17_DICDI KIN17-like protein OS=Dictyostelium discoideum GN=DDB_G0269816 PE=3 SV=1 1 210 3.0E-51
sp|P40962|RTS2_YEAST Zinc finger protein RTS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RTS2 PE=1 SV=1 4 124 4.0E-32

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 58 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10145
MPKAEVGSTKHLSNKLKSKGLQRLRWYCQVCEKQCRDANGFKMHTQSESHVRQMLVVGEDPKKFINEYSNQFLRD
FLQLLKTGHGEKQVHINQFYQEYIANKEHIHMNATKWPSLTEFAKYLGQESICRVEETEKGIHISWIDNSPEALQ
RQEALRRKEAQDQGDEQLEQRIIKEQIRRAQASATKRETNEEEDEEARNLKRNDGEKIKLSFGSKPKVQATESEA
TDASWQNSVAGSGASPNQSSVPSKEPAKASGFGGLTMKMTGKPQTKNVFAQAKKNALAAGTSKKAPAVDQPKKIS
EAERIMREEMERKRPRERAGFGQPPGKKPRNS*
Coding >Hirsu2|10145
ATGCCGAAGGCCGAGGTTGGCTCGACCAAGCATCTTTCCAACAAACTCAAAAGCAAAGGCCTCCAGCGCCTGCGA
TGGTACTGCCAGGTCTGCGAGAAGCAATGTCGAGACGCCAATGGATTTAAGATGCACACGCAGTCGGAAAGCCAC
GTGCGACAGATGCTGGTCGTCGGCGAGGATCCCAAGAAATTTATCAACGAATACAGCAACCAGTTCCTGAGGGAT
TTCCTGCAACTATTGAAGACGGGTCACGGCGAAAAGCAGGTGCACATCAACCAGTTCTACCAGGAATACATCGCC
AACAAGGAGCATATCCACATGAACGCCACAAAATGGCCCTCTTTAACTGAATTCGCCAAGTATCTAGGCCAAGAG
AGCATATGCCGAGTCGAAGAGACCGAGAAGGGAATCCATATTTCGTGGATCGACAACTCTCCAGAGGCGTTACAA
CGACAGGAAGCACTCCGCAGGAAGGAGGCGCAAGACCAGGGCGACGAGCAGCTGGAACAGCGCATCATCAAAGAG
CAGATCCGAAGAGCGCAGGCCAGCGCCACGAAACGCGAGACGAACGAAGAAGAGGACGAGGAGGCTCGGAACCTC
AAAAGGAACGATGGCGAGAAAATTAAATTGTCATTTGGCTCAAAACCGAAAGTACAGGCCACCGAGTCCGAGGCC
ACGGACGCCTCGTGGCAGAACTCGGTTGCTGGCTCAGGCGCGTCACCAAACCAGTCTTCAGTGCCCAGCAAGGAG
CCTGCGAAGGCCAGCGGCTTTGGCGGGCTCACCATGAAAATGACGGGCAAGCCGCAAACCAAAAATGTCTTTGCT
CAAGCAAAGAAAAACGCCTTGGCTGCTGGCACATCCAAGAAGGCTCCAGCAGTCGACCAGCCAAAGAAGATAAGC
GAAGCAGAGAGAATCATGAGGGAAGAAATGGAGCGGAAACGGCCACGAGAGCGTGCTGGGTTCGGCCAACCTCCC
GGAAAGAAGCCGAGGAACAGCTGA
Transcript >Hirsu2|10145
ATGCCGAAGGCCGAGGTTGGCTCGACCAAGCATCTTTCCAACAAACTCAAAAGCAAAGGCCTCCAGCGCCTGCGA
TGGTACTGCCAGGTCTGCGAGAAGCAATGTCGAGACGCCAATGGATTTAAGATGCACACGCAGTCGGAAAGCCAC
GTGCGACAGATGCTGGTCGTCGGCGAGGATCCCAAGAAATTTATCAACGAATACAGCAACCAGTTCCTGAGGGAT
TTCCTGCAACTATTGAAGACGGGTCACGGCGAAAAGCAGGTGCACATCAACCAGTTCTACCAGGAATACATCGCC
AACAAGGAGCATATCCACATGAACGCCACAAAATGGCCCTCTTTAACTGAATTCGCCAAGTATCTAGGCCAAGAG
AGCATATGCCGAGTCGAAGAGACCGAGAAGGGAATCCATATTTCGTGGATCGACAACTCTCCAGAGGCGTTACAA
CGACAGGAAGCACTCCGCAGGAAGGAGGCGCAAGACCAGGGCGACGAGCAGCTGGAACAGCGCATCATCAAAGAG
CAGATCCGAAGAGCGCAGGCCAGCGCCACGAAACGCGAGACGAACGAAGAAGAGGACGAGGAGGCTCGGAACCTC
AAAAGGAACGATGGCGAGAAAATTAAATTGTCATTTGGCTCAAAACCGAAAGTACAGGCCACCGAGTCCGAGGCC
ACGGACGCCTCGTGGCAGAACTCGGTTGCTGGCTCAGGCGCGTCACCAAACCAGTCTTCAGTGCCCAGCAAGGAG
CCTGCGAAGGCCAGCGGCTTTGGCGGGCTCACCATGAAAATGACGGGCAAGCCGCAAACCAAAAATGTCTTTGCT
CAAGCAAAGAAAAACGCCTTGGCTGCTGGCACATCCAAGAAGGCTCCAGCAGTCGACCAGCCAAAGAAGATAAGC
GAAGCAGAGAGAATCATGAGGGAAGAAATGGAGCGGAAACGGCCACGAGAGCGTGCTGGGTTCGGCCAACCTCCC
GGAAAGAAGCCGAGGAACAGCTGA
Gene >Hirsu2|10145
ATGCCGAAGGCCGAGGTTGGCTCGACCAAGCATCTTTCCAACAAACTCAAAAGCAAAGGCCTCCAGCGCCTGCGA
TGGTACTGCCAGGTCTGCGAGAAGCAATGTCGAGACGCCAATGGATTTAAGATGCACACGCAGTCGGAAAGCCAC
GTGCGACAGATGCTGGTCGTCGGCGAGGATCCCAAGAAATTTATCAACGAATACAGCAACCAGTTCCTGAGGGAT
TTCCTGCAACTATTGAAGACGGGTCACGGCGAAAAGCAGGTGCACATCAACCAGTTCTACCAGGAATACATCGCC
AACAAGGTGCGTGGGATTCCCGACTGCACGCCCATGCTTGTGGCCTACTGACAACGTGCAGGAGCATATCCACAT
GAACGCCACAAAATGGCCCTCTTTAACTGAATTCGCCAAGTATCTAGGCCAAGAGAGCATATGCCGAGTCGAAGA
GACCGAGAAGGGAATCCATATTTCGTGGATCGACAACTCTCCAGAGGCGTTACAACGACAGGAAGCACTCCGCAG
GAAGGAGGCGCAAGACCAGGGCGACGAGCAGCTGGAACAGCGCATCATCAAAGAGCAGATCCGAAGAGCGCAGGC
CAGCGCCACGAAACGCGAGACGAACGAAGAAGAGGACGAGGAGGCTCGGAACCTCAAAAGGAACGATGGCGAGAA
AATTAAATTGTCATTTGGCTCAAAACCGAAAGTACAGGCCACCGAGTCCGAGGCCACGGACGCCTCGTGGCAGAA
CTCGGTTGCTGGCTCAGGCGCGTCACCAAACCAGTCTTCAGTGCCCAGCAAGGAGCCTGCGAAGGCCAGCGGCTT
TGGCGGGCTCACCATGAAAATGACGGGCAAGCCGCAAACCAAAAATGTCTTTGCTCAAGCAAAGAAAAACGCCTT
GGCTGCTGGCACATCCAAGAAGGCTCCAGCAGTCGACCAGCCAAAGAAGATAAGCGAAGCAGAGAGAATCATGAG
GGAAGAAATGGAGCGGAAACGGCCACGAGAGCGTGCTGGGTTCGGCCAACCTCCCGGAAAGAAGCCGAGGAACAG
CTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail