Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10142
Gene name
LocationContig_796:11095..11828
Strand-
Gene length (bp)733
Transcript length (bp)675
Coding sequence length (bp)675
Protein length (aa) 225

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00485 PRK Phosphoribulokinase / Uridine kinase family 1.7E-05 26 167
PF00004 AAA ATPase family associated with various cellular activities (AAA) 2.9E-04 29 55

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UTC5|YIDE_SCHPO Putative uridine kinase C227.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC227.14 PE=3 SV=1 23 198 2.0E-43
sp|A7TQF3|YFH7_VANPO ATP-dependent kinase YFH7 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=YFH7 PE=3 SV=1 26 218 2.0E-28
sp|A7A245|YFH7_YEAS7 ATP-dependent kinase YFH7 OS=Saccharomyces cerevisiae (strain YJM789) GN=YFH7 PE=3 SV=1 51 218 5.0E-27
sp|B5VI33|YFH7_YEAS6 ATP-dependent kinase YFH7 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=YFH7 PE=3 SV=1 51 218 5.0E-27
sp|B3LUL5|YFH7_YEAS1 ATP-dependent kinase YFH7 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=YFH7 PE=3 SV=1 51 218 5.0E-27
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UTC5|YIDE_SCHPO Putative uridine kinase C227.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC227.14 PE=3 SV=1 23 198 2.0E-43
sp|A7TQF3|YFH7_VANPO ATP-dependent kinase YFH7 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=YFH7 PE=3 SV=1 26 218 2.0E-28
sp|A7A245|YFH7_YEAS7 ATP-dependent kinase YFH7 OS=Saccharomyces cerevisiae (strain YJM789) GN=YFH7 PE=3 SV=1 51 218 5.0E-27
sp|B5VI33|YFH7_YEAS6 ATP-dependent kinase YFH7 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=YFH7 PE=3 SV=1 51 218 5.0E-27
sp|B3LUL5|YFH7_YEAS1 ATP-dependent kinase YFH7 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=YFH7 PE=3 SV=1 51 218 5.0E-27
sp|C8Z7U0|YFH7_YEAS8 ATP-dependent kinase YFH7 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=YFH7 PE=3 SV=1 51 218 5.0E-27
sp|C7GYB3|YFH7_YEAS2 ATP-dependent kinase YFH7 OS=Saccharomyces cerevisiae (strain JAY291) GN=YFH7 PE=3 SV=1 51 218 5.0E-27
sp|P43591|YFH7_YEAST ATP-dependent kinase YFH7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YFH7 PE=1 SV=1 51 218 6.0E-27
sp|C5DXG0|YFH7_ZYGRC ATP-dependent kinase YFH7 OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=YFH7 PE=3 SV=1 26 218 3.0E-26
sp|C5DNG5|YFH7_LACTC ATP-dependent kinase YFH7 OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=YFH7 PE=3 SV=1 25 213 9.0E-25
sp|Q750K6|YFH7_ASHGO ATP-dependent kinase YFH7 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=YFH7 PE=3 SV=1 25 202 2.0E-21
sp|Q6CNA8|YFH7_KLULA ATP-dependent kinase YFH7 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=YFH7 PE=3 SV=1 51 199 2.0E-19
sp|P11664|YGGC_ECOLI Uncharacterized protein YggC OS=Escherichia coli (strain K12) GN=yggC PE=4 SV=2 3 219 2.0E-17
sp|Q6FUM2|YFH7_CANGA ATP-dependent kinase YFH7 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=YFH7 PE=3 SV=1 49 218 2.0E-17
sp|C0ZAS6|URK_BREBN Uridine kinase OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=udk PE=3 SV=1 25 189 3.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016301 kinase activity Yes
GO:0005524 ATP binding Yes
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0017076 purine nucleotide binding No
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0008144 drug binding No
GO:0036094 small molecule binding No
GO:1901265 nucleoside phosphate binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0097367 carbohydrate derivative binding No
GO:0043168 anion binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10142
MEEQVERLASKAWARYQCTPADQRLLIGIAGIPGSGKTTLARAVARRLDADVCAVVPMDGFHLTRAALSALPDPA
RAHARRGAAFTFAAAKFLRLVRALRARPPSPVLAPSFDHAAKDPVEDDIAVGPAHRLVLLEGNYLALDEPVWREA
AALLDELWFVDVDAAVARRRLCARHVRAGIARDFDEANRRVSENDLVNGDEILARRLPVDELVESREDGGWVHD*
Coding >Hirsu2|10142
ATGGAAGAGCAGGTCGAGCGCCTCGCCTCGAAGGCGTGGGCGCGGTACCAGTGCACGCCCGCCGACCAACGGCTG
CTGATCGGCATCGCCGGAATCCCCGGGTCGGGCAAGACGACGCTGGCGCGGGCGGTGGCGCGGCGGCTGGACGCG
GACGTGTGCGCCGTCGTGCCCATGGACGGCTTCCACCTGACGCGGGCGGCGCTGTCGGCGCTGCCGGACCCGGCG
CGGGCGCACGCCCGCCGCGGCGCCGCCTTCACCTTCGCGGCGGCCAAGTTCCTGCGCCTGGTGCGGGCGCTGCGG
GCGCGGCCGCCGTCGCCCGTGCTCGCGCCCTCCTTCGACCACGCGGCCAAGGACCCGGTCGAGGACGACATCGCG
GTCGGGCCGGCCCACCGCCTCGTCCTGCTCGAGGGCAACTACCTGGCGCTCGACGAGCCGGTCTGGCGTGAGGCG
GCCGCGCTGCTGGACGAGCTGTGGTTCGTCGACGTCGATGCCGCCGTCGCCCGGCGCCGCCTGTGCGCCCGCCAT
GTCCGCGCCGGCATCGCCCGCGACTTCGACGAGGCCAACCGCCGCGTCAGCGAAAACGACCTGGTCAACGGGGAC
GAGATCCTGGCCCGTCGTCTACCAGTCGACGAGCTGGTCGAGAGCCGCGAGGACGGCGGCTGGGTCCACGACTGA
Transcript >Hirsu2|10142
ATGGAAGAGCAGGTCGAGCGCCTCGCCTCGAAGGCGTGGGCGCGGTACCAGTGCACGCCCGCCGACCAACGGCTG
CTGATCGGCATCGCCGGAATCCCCGGGTCGGGCAAGACGACGCTGGCGCGGGCGGTGGCGCGGCGGCTGGACGCG
GACGTGTGCGCCGTCGTGCCCATGGACGGCTTCCACCTGACGCGGGCGGCGCTGTCGGCGCTGCCGGACCCGGCG
CGGGCGCACGCCCGCCGCGGCGCCGCCTTCACCTTCGCGGCGGCCAAGTTCCTGCGCCTGGTGCGGGCGCTGCGG
GCGCGGCCGCCGTCGCCCGTGCTCGCGCCCTCCTTCGACCACGCGGCCAAGGACCCGGTCGAGGACGACATCGCG
GTCGGGCCGGCCCACCGCCTCGTCCTGCTCGAGGGCAACTACCTGGCGCTCGACGAGCCGGTCTGGCGTGAGGCG
GCCGCGCTGCTGGACGAGCTGTGGTTCGTCGACGTCGATGCCGCCGTCGCCCGGCGCCGCCTGTGCGCCCGCCAT
GTCCGCGCCGGCATCGCCCGCGACTTCGACGAGGCCAACCGCCGCGTCAGCGAAAACGACCTGGTCAACGGGGAC
GAGATCCTGGCCCGTCGTCTACCAGTCGACGAGCTGGTCGAGAGCCGCGAGGACGGCGGCTGGGTCCACGACTGA
Gene >Hirsu2|10142
ATGGAAGAGCAGGTCGAGCGCCTCGCCTCGAAGGCGTGGGCGCGGTACCAGTGCACGCCCGCCGACCAACGGCTG
CGTACGTCGTGACCGTCTTCTGTCCGGTGACGTCGGCCGACTGACCCGGGCTCGCGCAGTGATCGGCATCGCCGG
AATCCCCGGGTCGGGCAAGACGACGCTGGCGCGGGCGGTGGCGCGGCGGCTGGACGCGGACGTGTGCGCCGTCGT
GCCCATGGACGGCTTCCACCTGACGCGGGCGGCGCTGTCGGCGCTGCCGGACCCGGCGCGGGCGCACGCCCGCCG
CGGCGCCGCCTTCACCTTCGCGGCGGCCAAGTTCCTGCGCCTGGTGCGGGCGCTGCGGGCGCGGCCGCCGTCGCC
CGTGCTCGCGCCCTCCTTCGACCACGCGGCCAAGGACCCGGTCGAGGACGACATCGCGGTCGGGCCGGCCCACCG
CCTCGTCCTGCTCGAGGGCAACTACCTGGCGCTCGACGAGCCGGTCTGGCGTGAGGCGGCCGCGCTGCTGGACGA
GCTGTGGTTCGTCGACGTCGATGCCGCCGTCGCCCGGCGCCGCCTGTGCGCCCGCCATGTCCGCGCCGGCATCGC
CCGCGACTTCGACGAGGCCAACCGCCGCGTCAGCGAAAACGACCTGGTCAACGGGGACGAGATCCTGGCCCGTCG
TCTACCAGTCGACGAGCTGGTCGAGAGCCGCGAGGACGGCGGCTGGGTCCACGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail