Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10138
Gene name
LocationContig_796:2193..3612
Strand-
Gene length (bp)1419
Transcript length (bp)1242
Coding sequence length (bp)1242
Protein length (aa) 414

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01699 Na_Ca_ex Sodium/calcium exchanger protein 8.7E-17 59 218
PF01699 Na_Ca_ex Sodium/calcium exchanger protein 7.3E-10 264 403

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q99385|VCX1_YEAST Vacuolar calcium ion transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VCX1 PE=1 SV=1 1 413 5.0E-56
sp|O59768|VCX1_SCHPO Vacuolar calcium ion transporter OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vcx1 PE=3 SV=1 41 410 1.0E-55
sp|Q75XW3|CAX_APHHA Ca(2+)/H(+) antiporter OS=Aphanothece halophytica PE=1 SV=1 41 409 3.0E-54
sp|Q8L783|CAX5_ARATH Vacuolar cation/proton exchanger 5 OS=Arabidopsis thaliana GN=CAX5 PE=2 SV=1 38 411 4.0E-50
sp|P74072|CAX_SYNY3 Ca(2+)/H(+) antiporter OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr1336 PE=1 SV=1 41 409 9.0E-49
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q99385|VCX1_YEAST Vacuolar calcium ion transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VCX1 PE=1 SV=1 1 413 5.0E-56
sp|O59768|VCX1_SCHPO Vacuolar calcium ion transporter OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vcx1 PE=3 SV=1 41 410 1.0E-55
sp|Q75XW3|CAX_APHHA Ca(2+)/H(+) antiporter OS=Aphanothece halophytica PE=1 SV=1 41 409 3.0E-54
sp|Q8L783|CAX5_ARATH Vacuolar cation/proton exchanger 5 OS=Arabidopsis thaliana GN=CAX5 PE=2 SV=1 38 411 4.0E-50
sp|P74072|CAX_SYNY3 Ca(2+)/H(+) antiporter OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr1336 PE=1 SV=1 41 409 9.0E-49
sp|Q39254|CAX2_ARATH Vacuolar cation/proton exchanger 2 OS=Arabidopsis thaliana GN=CAX2 PE=1 SV=2 38 411 4.0E-48
sp|Q6K1C4|CAX3_ORYSJ Vacuolar cation/proton exchanger 3 OS=Oryza sativa subsp. japonica GN=CAX3 PE=2 SV=2 64 412 1.0E-45
sp|Q9LFZ8|CAX6_ARATH Putative vacuolar cation/proton exchanger 6 OS=Arabidopsis thaliana GN=CAX6 PE=3 SV=3 38 411 1.0E-44
sp|Q5KQN0|CAX2_ORYSJ Vacuolar cation/proton exchanger 2 OS=Oryza sativa subsp. japonica GN=CAX2 PE=2 SV=2 35 407 5.0E-44
sp|Q6YXZ1|CAX4_ORYSJ Putative vacuolar cation/proton exchanger 4 OS=Oryza sativa subsp. japonica GN=Os02g0138900 PE=3 SV=1 52 407 3.0E-41
sp|Q945S5|CAX4_ARATH Vacuolar cation/proton exchanger 4 OS=Arabidopsis thaliana GN=CAX4 PE=1 SV=2 37 413 7.0E-36
sp|Q5TKG3|CAX1B_ORYSJ Vacuolar cation/proton exchanger 1b OS=Oryza sativa subsp. japonica GN=CAX1b PE=2 SV=1 45 412 3.0E-34
sp|Q39253|CAX1_ARATH Vacuolar cation/proton exchanger 1 OS=Arabidopsis thaliana GN=CAX1 PE=1 SV=3 66 413 3.0E-34
sp|Q769E5|CAX1A_ORYSJ Vacuolar cation/proton exchanger 1a OS=Oryza sativa subsp. japonica GN=CAX1a PE=1 SV=1 45 410 2.0E-33
sp|Q93Z81|CAX3_ARATH Vacuolar cation/proton exchanger 3 OS=Arabidopsis thaliana GN=CAX3 PE=1 SV=1 38 407 3.0E-33
sp|Q5KTQ9|CAX1C_ORYSJ Vacuolar cation/proton exchanger 1c OS=Oryza sativa subsp. japonica GN=CAX1c PE=2 SV=1 45 407 1.0E-28
sp|O34840|CHAA_BACSU Ca(2+)/H(+) antiporter ChaA OS=Bacillus subtilis (strain 168) GN=chaA PE=1 SV=1 45 407 2.0E-24
sp|P42839|VNX1_YEAST Low affinity vacuolar monovalent cation/H(+) antiporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VNX1 PE=1 SV=1 65 406 2.0E-16
sp|Q9P7B3|YI14_SCHPO Putative cation exchanger C521.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC521.04c PE=1 SV=1 66 253 5.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 51 0.5

Transmembrane Domains

Domain # Start End Length
1 55 77 22
2 90 112 22
3 122 144 22
4 157 179 22
5 194 216 22
6 261 283 22
7 298 320 22
8 327 349 22
9 364 381 17
10 386 408 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10138
MDETEPLLSASAEPGDRPGLPARGPHWPRPSHWPRPGLRTLLVFVPLALGGRRLGWHDVVVSAFCLLAIISLSDL
ISAASDTMGNRWGRSVGGLVNATFGNTIELLVSLFAIRHDEIRVAQAIMLGSILSDILLVLGFCIIAGARRRGVI
SVAPAIVDVLSSLMLVSAMALVIPAALYAALPRTDGQGADMTRNILTFSRATATVLLFVYATYLYFQLRTHSFLF
LQDKDDGEPDVYENPTTGDGSSDGEDSALPTTRNVYFAILVLSTAALLTGLCTQAFMASLDGMTRSLRITKTFVA
LILIPFASNSPEMTQVVAASRNNKITFAVSVIIDSILQISLLALPALVILGWLMGRAMDLFFEPSQAYTLLFSVI
LVNQVLQDRHYTYLHGAMLLSVYAVVAAAHFIAPQQST*
Coding >Hirsu2|10138
ATGGACGAGACCGAACCGCTGTTGAGCGCTTCCGCCGAGCCCGGCGACAGGCCCGGCCTCCCGGCCCGGGGGCCG
CACTGGCCTCGGCCGTCGCACTGGCCACGGCCCGGCCTCAGGACCCTCCTGGTGTTCGTACCGCTGGCGCTAGGC
GGCCGGCGGCTGGGCTGGCATGATGTTGTCGTGTCGGCCTTCTGCCTCCTCGCCATCATCTCTCTGTCGGACCTC
ATCTCGGCCGCGTCGGACACGATGGGCAACCGCTGGGGCAGGTCGGTCGGCGGCCTGGTCAACGCCACCTTTGGC
AACACCATCGAGCTACTTGTGAGCCTCTTCGCCATCCGCCATGACGAGATCCGCGTGGCCCAAGCCATCATGCTC
GGCAGCATTCTCTCGGACATCCTGCTGGTCCTCGGCTTCTGCATCATAGCCGGAGCCCGCCGCCGTGGCGTCATA
TCCGTTGCTCCGGCCATCGTCGACGTCCTGTCCTCGCTGATGCTCGTGTCCGCAATGGCCCTCGTCATACCCGCC
GCCCTCTATGCGGCCTTGCCTCGAACTGACGGCCAGGGCGCCGACATGACCCGCAACATCTTGACCTTTAGTCGC
GCCACGGCTACTGTGTTACTATTCGTGTACGCCACGTATCTCTACTTCCAGCTCAGGACGCATTCGTTCCTGTTC
CTGCAGGACAAGGACGACGGGGAGCCCGATGTCTACGAGAATCCAACGACCGGAGATGGCTCAAGTGATGGCGAA
GACAGTGCCTTGCCCACCACGCGCAACGTGTATTTCGCGATCCTTGTTCTGTCTACCGCCGCTCTCCTTACCGGC
CTCTGCACGCAGGCTTTCATGGCGAGCCTCGACGGCATGACTCGGTCCCTTCGCATCACCAAGACCTTTGTGGCC
CTGATCCTAATCCCCTTTGCAAGCAACTCTCCCGAGATGACGCAGGTGGTTGCCGCCTCTCGCAACAACAAGATC
ACCTTTGCCGTTTCCGTCATAATCGACAGCATCCTTCAAATTTCACTTCTTGCTCTTCCTGCGCTCGTCATCCTC
GGCTGGCTCATGGGCAGAGCTATGGACTTGTTCTTTGAGCCATCGCAGGCTTATACCCTACTTTTCTCCGTCATC
CTCGTGAACCAAGTGCTACAGGATCGGCACTACACATATCTGCACGGCGCCATGCTCCTATCTGTCTATGCTGTC
GTCGCAGCAGCCCACTTCATAGCGCCACAACAATCCACATGA
Transcript >Hirsu2|10138
ATGGACGAGACCGAACCGCTGTTGAGCGCTTCCGCCGAGCCCGGCGACAGGCCCGGCCTCCCGGCCCGGGGGCCG
CACTGGCCTCGGCCGTCGCACTGGCCACGGCCCGGCCTCAGGACCCTCCTGGTGTTCGTACCGCTGGCGCTAGGC
GGCCGGCGGCTGGGCTGGCATGATGTTGTCGTGTCGGCCTTCTGCCTCCTCGCCATCATCTCTCTGTCGGACCTC
ATCTCGGCCGCGTCGGACACGATGGGCAACCGCTGGGGCAGGTCGGTCGGCGGCCTGGTCAACGCCACCTTTGGC
AACACCATCGAGCTACTTGTGAGCCTCTTCGCCATCCGCCATGACGAGATCCGCGTGGCCCAAGCCATCATGCTC
GGCAGCATTCTCTCGGACATCCTGCTGGTCCTCGGCTTCTGCATCATAGCCGGAGCCCGCCGCCGTGGCGTCATA
TCCGTTGCTCCGGCCATCGTCGACGTCCTGTCCTCGCTGATGCTCGTGTCCGCAATGGCCCTCGTCATACCCGCC
GCCCTCTATGCGGCCTTGCCTCGAACTGACGGCCAGGGCGCCGACATGACCCGCAACATCTTGACCTTTAGTCGC
GCCACGGCTACTGTGTTACTATTCGTGTACGCCACGTATCTCTACTTCCAGCTCAGGACGCATTCGTTCCTGTTC
CTGCAGGACAAGGACGACGGGGAGCCCGATGTCTACGAGAATCCAACGACCGGAGATGGCTCAAGTGATGGCGAA
GACAGTGCCTTGCCCACCACGCGCAACGTGTATTTCGCGATCCTTGTTCTGTCTACCGCCGCTCTCCTTACCGGC
CTCTGCACGCAGGCTTTCATGGCGAGCCTCGACGGCATGACTCGGTCCCTTCGCATCACCAAGACCTTTGTGGCC
CTGATCCTAATCCCCTTTGCAAGCAACTCTCCCGAGATGACGCAGGTGGTTGCCGCCTCTCGCAACAACAAGATC
ACCTTTGCCGTTTCCGTCATAATCGACAGCATCCTTCAAATTTCACTTCTTGCTCTTCCTGCGCTCGTCATCCTC
GGCTGGCTCATGGGCAGAGCTATGGACTTGTTCTTTGAGCCATCGCAGGCTTATACCCTACTTTTCTCCGTCATC
CTCGTGAACCAAGTGCTACAGGATCGGCACTACACATATCTGCACGGCGCCATGCTCCTATCTGTCTATGCTGTC
GTCGCAGCAGCCCACTTCATAGCGCCACAACAATCCACATGA
Gene >Hirsu2|10138
ATGGACGAGACCGAACCGCTGTTGAGCGCTTCCGCCGAGCCCGGCGACAGGCCCGGCCTCCCGGCCCGGGGGCCG
CACTGGCCTCGGCCGTCGCACTGGCCACGGCCCGGCCTCAGGACCCTCCTGGTGTTCGTACCGCTGGCGCTAGGC
GGCCGGCGGCTGGGCTGGCATGATGTTGTCGTGTCGGCCTTCTGCCTCCTCGCCATCATCTCTCTGTCGGACCTC
ATCTCGGCCGCGTCGGACACGATGGGCAACCGCTGGGGCAGGTCGGTCGGCGGCCTGGTCAACGCCACCTTTGGC
AACACCATCGAGCTACTTGTACGAGAGCAGCGGCCCGGCCATGCGGCGAGCAGCTGGACTGACGCAAGCAGGTGA
GCCTCTTCGCCATCCGCCATGACGAGATCCGCGTGGCCCAAGCCATCATGCTCGGCAGCATTCTCTCGGACATCC
TGCTGGTCCGTCTGATAGCCCCCCTCTCGGCCTGTCGACACGCTGATGATCGCTCACTTAGGTCCTCGGCTTCTG
CATCATAGCCGGAGCCCGCCGCCGTGGCGTCATATCCGTTGCTCCGGCCATCGTCGACGTCCTGTCCTCGCTGAT
GCTCGTGTCCGCAATGGCCCTCGTCATACCCGCCGCCCTCTATGCGGCCTTGCCTCGAACTGACGGCCAGGGCGC
CGACATGACCCGCAACATCTTGACCTTTAGTCGCGCCACGGCTACTGTGTTACTATTCGTGTACGCCACGTATCT
CTACTTCCAGCTCAGGACGCATTCGTTCCTGTTCCTGCAGGACAAGGACGACGGGGAGCCCGATGTCTACGAGAA
TCCAACGACCGGAGATGGCTCAAGTGATGGCGAAGACAGTGCCTTGCCCACCACGCGCAACGTGTATTTCGCGAT
CCTTGTTCTGTCTACCGCCGCTCTCCTTACCGGCCTCTGCACGCAGGCTTTCATGGCGAGCCTCGACGGCATGAC
TCGGTCCCTTCGCATCACCAAGACCTTTGTGGCCCTGATCCTAATCCCCTTTGCAAGCAACTCTCCCGAGATGAC
GCAGGTGGTTGCCGCCTCTCGCAACAACAAGATCACCTTTGCCGTTTCCGTCATAATCGACAGCATCCTTCAAAT
TTCACTTCTTGCTCTTCCTGCGCTCGTCATCCTCGGCTGGCTCATGGGCAGAGCTATGGACTTGTTCTTTGAGCC
ATCGCAGGCTTATACCCTACTTTTCTCCGTCATCCTCGTGAACCAAGTGCTACAGGATCGGCACTACACATATCT
GCACGGCGCCATGCTCCTATCTGTGTAAGTTTCGCAGAAGTCGGATAAGACCACGGCTCCGAACAGTCACTAACA
GATGTGATTTATTGCAGCTATGCTGTCGTCGCAGCAGCCCACTTCATAGCGCCACAACAATCCACATGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail