Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10134
Gene name
LocationContig_795:5687..10795
Strand+
Gene length (bp)5108
Transcript length (bp)4743
Coding sequence length (bp)4743
Protein length (aa) 1581

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01822 WSC WSC domain 2.1E-16 924 1002
PF01822 WSC WSC domain 1.0E-17 1047 1125
PF01822 WSC WSC domain 6.0E-18 1193 1271
PF01822 WSC WSC domain 5.4E-14 1480 1564

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 922 1284 3.0E-31
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 1038 1283 5.0E-30
sp|P84675|PFM_CHAGB Putative fungistatic metabolite OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_05463 PE=1 SV=2 1036 1280 8.0E-28
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 812 1132 1.0E-22
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 1191 1296 4.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 922 1284 3.0E-31
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 1038 1283 5.0E-30
sp|P84675|PFM_CHAGB Putative fungistatic metabolite OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_05463 PE=1 SV=2 1036 1280 8.0E-28
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 812 1132 1.0E-22
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 1191 1296 4.0E-19
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 915 1133 4.0E-18
sp|P84675|PFM_CHAGB Putative fungistatic metabolite OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_05463 PE=1 SV=2 914 1133 1.0E-16
sp|Q80XH4|WSCD1_MOUSE WSC domain-containing protein 1 OS=Mus musculus GN=Wscd1 PE=2 SV=1 1023 1259 1.0E-15
sp|A2BGL3|WSCD2_DANRE WSC domain-containing protein 2 OS=Danio rerio GN=wscd2 PE=3 SV=1 1047 1280 1.0E-14
sp|D4PHA7|WSCD2_MOUSE WSC domain-containing protein 2 OS=Mus musculus GN=Wscd2 PE=2 SV=1 923 1137 2.0E-14
sp|A2BGL3|WSCD2_DANRE WSC domain-containing protein 2 OS=Danio rerio GN=wscd2 PE=3 SV=1 920 1137 3.0E-14
sp|Q2TBF2|WSCD2_HUMAN WSC domain-containing protein 2 OS=Homo sapiens GN=WSCD2 PE=2 SV=2 923 1137 6.0E-14
sp|Q0IIY2|WSCD1_XENTR WSC domain-containing protein 1 OS=Xenopus tropicalis GN=wscd1 PE=2 SV=1 886 1096 2.0E-13
sp|Q658N2|WSCD1_HUMAN WSC domain-containing protein 1 OS=Homo sapiens GN=WSCD1 PE=2 SV=1 1030 1162 4.0E-13
sp|D4PHA7|WSCD2_MOUSE WSC domain-containing protein 2 OS=Mus musculus GN=Wscd2 PE=2 SV=1 1047 1280 7.0E-13
sp|Q505J3|WSCD1_RAT WSC domain-containing protein 1 OS=Rattus norvegicus GN=Wscd1 PE=2 SV=1 910 1137 3.0E-12
sp|A2BGL3|WSCD2_DANRE WSC domain-containing protein 2 OS=Danio rerio GN=wscd2 PE=3 SV=1 1189 1288 7.0E-12
sp|P84675|PFM_CHAGB Putative fungistatic metabolite OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_05463 PE=1 SV=2 1193 1286 2.0E-11
sp|Q80XH4|WSCD1_MOUSE WSC domain-containing protein 1 OS=Mus musculus GN=Wscd1 PE=2 SV=1 910 1137 2.0E-11
sp|D4PHA7|WSCD2_MOUSE WSC domain-containing protein 2 OS=Mus musculus GN=Wscd2 PE=2 SV=1 1193 1281 8.0E-11
sp|Q658N2|WSCD1_HUMAN WSC domain-containing protein 1 OS=Homo sapiens GN=WSCD1 PE=2 SV=1 910 1123 9.0E-11
sp|Q2TBF2|WSCD2_HUMAN WSC domain-containing protein 2 OS=Homo sapiens GN=WSCD2 PE=2 SV=2 1190 1281 1.0E-10
sp|Q0IIY2|WSCD1_XENTR WSC domain-containing protein 1 OS=Xenopus tropicalis GN=wscd1 PE=2 SV=1 1032 1164 1.0E-10
sp|Q80XH4|WSCD1_MOUSE WSC domain-containing protein 1 OS=Mus musculus GN=Wscd1 PE=2 SV=1 1472 1573 2.0E-10
sp|Q505J3|WSCD1_RAT WSC domain-containing protein 1 OS=Rattus norvegicus GN=Wscd1 PE=2 SV=1 1479 1573 4.0E-10
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 1472 1575 7.0E-10
sp|Q7KVA1|XYLT_DROME Xylosyltransferase oxt OS=Drosophila melanogaster GN=oxt PE=2 SV=1 1045 1192 1.0E-09
sp|Q5QQ53|XYLT_DROPS Xylosyltransferase oxt OS=Drosophila pseudoobscura pseudoobscura GN=oxt PE=2 SV=1 1045 1151 2.0E-09
sp|A2BGL3|WSCD2_DANRE WSC domain-containing protein 2 OS=Danio rerio GN=wscd2 PE=3 SV=1 1451 1572 1.0E-08
sp|Q658N2|WSCD1_HUMAN WSC domain-containing protein 1 OS=Homo sapiens GN=WSCD1 PE=2 SV=1 1478 1572 1.0E-08
sp|P84675|PFM_CHAGB Putative fungistatic metabolite OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_05463 PE=1 SV=2 1478 1577 2.0E-08
sp|Q0IIY2|WSCD1_XENTR WSC domain-containing protein 1 OS=Xenopus tropicalis GN=wscd1 PE=2 SV=1 1178 1283 5.0E-08
sp|Q505J3|WSCD1_RAT WSC domain-containing protein 1 OS=Rattus norvegicus GN=Wscd1 PE=2 SV=1 1177 1279 5.0E-08
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 1477 1578 6.0E-08
sp|D4PHA7|WSCD2_MOUSE WSC domain-containing protein 2 OS=Mus musculus GN=Wscd2 PE=2 SV=1 1479 1572 8.0E-08
sp|Q924S4|KREM1_RAT Kremen protein 1 OS=Rattus norvegicus GN=Kremen1 PE=2 SV=1 1195 1311 9.0E-08
sp|Q80XH4|WSCD1_MOUSE WSC domain-containing protein 1 OS=Mus musculus GN=Wscd1 PE=2 SV=1 1176 1286 1.0E-07
sp|Q658N2|WSCD1_HUMAN WSC domain-containing protein 1 OS=Homo sapiens GN=WSCD1 PE=2 SV=1 1172 1286 1.0E-07
sp|Q965Q8|XYLT_CAEEL Xylosyltransferase sqv-6 OS=Caenorhabditis elegans GN=sqv-6 PE=1 SV=3 1047 1144 1.0E-07
sp|Q2TBF2|WSCD2_HUMAN WSC domain-containing protein 2 OS=Homo sapiens GN=WSCD2 PE=2 SV=2 1478 1572 2.0E-07
sp|Q99N43|KREM1_MOUSE Kremen protein 1 OS=Mus musculus GN=Kremen1 PE=2 SV=2 1195 1311 2.0E-07
sp|Q96MU8|KREM1_HUMAN Kremen protein 1 OS=Homo sapiens GN=KREMEN1 PE=2 SV=3 1195 1279 3.0E-07
sp|Q7KVA1|XYLT_DROME Xylosyltransferase oxt OS=Drosophila melanogaster GN=oxt PE=2 SV=1 925 1002 6.0E-07
sp|Q90Y90|KREM1_XENLA Kremen protein 1 OS=Xenopus laevis GN=kremen1 PE=2 SV=1 1039 1175 9.0E-07
sp|Q0IIY2|WSCD1_XENTR WSC domain-containing protein 1 OS=Xenopus tropicalis GN=wscd1 PE=2 SV=1 1478 1572 1.0E-06
sp|Q8NCW0|KREM2_HUMAN Kremen protein 2 OS=Homo sapiens GN=KREMEN2 PE=2 SV=1 1047 1134 4.0E-06
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 1477 1576 6.0E-06
sp|Q8NCW0|KREM2_HUMAN Kremen protein 2 OS=Homo sapiens GN=KREMEN2 PE=2 SV=1 1193 1282 7.0E-06
sp|Q8K1S7|KREM2_MOUSE Kremen protein 2 OS=Mus musculus GN=Kremen2 PE=1 SV=1 1193 1282 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

Domain # Start End Length
1 1385 1407 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10134
MKPLGSGSLLVSALVGLASGLGSTDTTTWGGDNSRTGFETNHNMDPAVVGSPQFGQLFSTLLPGSFAGQPEQIYS
QPLVYTPSGGSRQFVYVATTLNNVYKLDAKTGAVVASRKLHIPFQTADLDGCVDINPAVGVTSTGVIDPATDTLY
LTAKTYADQSQTERPQGRPAGRYYLHALDAGDLTERANFPVDLEGTVARNNANRTFTAGIHLQRPALLLSGQYVY
AGFASHCVQYNFTGWIMGWDKASGRTVERLTTEGAGVPDAVKGGGIWMSGGGISSDDAGSLFLGTGNGYASQLSN
IPVRGYAPPSSLEEAALHLTMQADGSLSLVDFFMPWEKQALDGGDKDLGTTPLALLPRQFACGDVRRIGVITGKT
GKTYWLNLDSLGGYRNGRDGLDDVVQVYQNENSVYSGAGVYPLEGGYVYINVIQNPTAVFKFSCSAAGVPAFTKV
AVSPSANAYILGVSHGAVTALPGQDGTGLLWVTDVQGLNLRIYAAVPRDGLLTMLNSFNVPGVTKFARPVFGDGI
AYVGTTTGYLYAFGSPVNPPLNCSSPVDFGTVDLGSAAPGPARPVTCRANVGLTVTGLGLGDRRDFAIASAPALP
LQLAQGQSFAVNATFSPTAVGFLSVDLLVNSTNAAAGYSAATHARLTGTGRSPGALLALSPNTISFQGVVTGQDP
AGVSESLIISNRGNAPLTVRSVLVSADNATGPPRPWAGPADLVVGKFTLQKVPATVAANAAVTVAVLFNSSASGT
FSGSVRFVTDGGNGTVSIYGSSGPAAAALIEFQTTDGAGWVPYRPGTPFSFGNVTENTARALKLRVTNSAAAGGV
RLSLTVSKPPFGVAGLIRAANQVDLAEGSSLAPGESGTAVLTCAAPKSQWNVAAYNGTAQWTINTNDPAMGKQFI
QFACNAVAEQAPPLLPGGQGQYRYVGCFKDNTPGRQLPNQLVADDKLANAQCIAACAKAGYAFCGTEYLRECWAG
NQLPLQKVDEANCNYNCAGDVNQICGGNGVNDAAGGTFMSLFADSLQWDGNYTRPPVSGPAVNPGVSGFASIGCY
TEPSNARALPNGVNTDKRTVAACVNACKAAAYSFAGMEYGGECWCGNALTTGSVSAPDADCGMTCNDNSTEYCGG
PSRLNVYRLGTQLPSSSSSSSSSTTGPSSSTGSAPSTSPTSPTSSSSSSATPTPTGPAVKNAVGRYLFQGCWTEA
TNSRALLGNAYADDKMTLETCAKFCDGFKYFAAEYGRECYCGNELQAGSARAAAQADCSFPCAGDGSEYCGAGNR
LQLYRLADSVPTASSGPSLAGGGGADSTSSAAVSTSCLALLFRHSALEYLGRPELNLGGRYLDVYGPGFVRVCLC
AVLGLFRRQLGWAVFYSDNGNPLGHFGVFLDSRGLLLFFLLLFLLLLFLFGPANLFFGRGQQLGNPGCQLLVNDC
HSFHHTKHISHRIILESSEPDPRHLGIELTTASTSASATPTGPIVWPGNANFTFYSCVSEPSNGRLLDLQMLNDA
KNMTIDSCLRKCYNYQWAGVEYGQECWCGNKLNLAGNDGATPGKNVTKTECNMICPGDKNVYCGAGVRLSLYSNN
ATTTR*
Coding >Hirsu2|10134
ATGAAGCCCCTGGGCAGCGGGTCACTGCTGGTGTCGGCCCTGGTGGGCCTGGCCAGCGGCCTCGGCTCGACCGAT
ACGACGACCTGGGGAGGGGACAACTCGCGTACGGGATTCGAGACGAACCACAACATGGACCCGGCCGTGGTGGGC
AGCCCGCAGTTCGGACAGCTCTTCAGCACGCTGCTGCCCGGCAGCTTCGCCGGCCAGCCGGAGCAGATCTACTCG
CAGCCGCTGGTGTACACGCCGAGCGGCGGCAGCCGGCAGTTCGTGTACGTGGCGACGACGCTCAACAACGTGTAC
AAGCTGGACGCCAAGACGGGGGCGGTGGTGGCGTCGCGCAAGCTGCACATACCCTTCCAGACGGCCGACCTGGAC
GGCTGCGTCGACATCAACCCGGCGGTCGGGGTGACGTCGACGGGCGTCATCGACCCGGCCACCGACACGCTCTAC
CTGACGGCCAAGACGTACGCGGACCAGAGCCAGACGGAGCGGCCGCAGGGCCGGCCGGCCGGGCGGTACTACCTG
CACGCGCTCGACGCCGGCGACCTGACGGAGCGGGCCAACTTCCCGGTCGACCTGGAGGGCACGGTGGCGCGCAAC
AACGCGAACCGGACGTTCACGGCCGGCATCCACCTGCAGCGGCCGGCGCTGCTGCTGAGCGGGCAGTACGTGTAC
GCCGGGTTCGCCTCGCACTGCGTGCAGTACAACTTCACCGGCTGGATCATGGGCTGGGACAAGGCCAGCGGGCGG
ACGGTGGAGCGGCTGACGACGGAGGGCGCCGGCGTGCCGGACGCGGTCAAGGGCGGCGGCATCTGGATGTCGGGC
GGCGGCATCTCGTCCGACGACGCCGGCTCGCTCTTCCTCGGCACCGGCAACGGCTACGCGTCGCAGCTCAGCAAC
ATCCCGGTGCGCGGCTACGCGCCGCCCAGCTCGCTCGAGGAGGCGGCGCTGCACCTGACGATGCAGGCCGACGGC
AGCCTCAGCCTCGTCGACTTCTTCATGCCGTGGGAGAAGCAGGCGCTGGACGGGGGCGACAAGGACCTGGGCACG
ACGCCGCTGGCGCTGCTGCCGCGCCAGTTCGCCTGCGGCGACGTCCGCCGCATCGGCGTCATCACCGGCAAGACG
GGCAAGACGTACTGGCTCAACCTCGACAGCCTGGGCGGCTACCGCAACGGCCGCGACGGGCTCGACGACGTCGTC
CAGGTCTACCAGAACGAGAACTCGGTCTACAGCGGCGCCGGCGTCTACCCGCTCGAGGGCGGCTACGTCTACATC
AACGTCATCCAGAACCCGACGGCCGTCTTCAAGTTCTCGTGCAGCGCCGCCGGCGTCCCGGCCTTCACCAAGGTC
GCCGTCTCGCCCTCGGCCAACGCCTACATCCTCGGCGTCAGCCACGGCGCCGTCACCGCCCTGCCCGGCCAGGAC
GGCACCGGCCTGCTCTGGGTCACCGACGTCCAGGGGCTCAACCTGCGCATCTACGCCGCCGTCCCGCGCGACGGC
CTGCTGACCATGCTCAACTCGTTCAACGTCCCGGGCGTCACCAAGTTCGCCCGGCCCGTCTTCGGCGACGGCATC
GCCTACGTCGGCACCACCACCGGCTACCTCTACGCCTTCGGCTCGCCCGTCAACCCGCCCCTCAACTGCTCCTCG
CCCGTCGACTTCGGCACCGTCGACCTCGGCTCCGCCGCCCCCGGCCCGGCCCGGCCCGTCACCTGCCGCGCCAAC
GTCGGCCTGACCGTCACCGGCCTCGGCCTCGGCGACCGCCGCGACTTCGCCATCGCCTCCGCGCCCGCCCTGCCG
CTGCAGCTGGCCCAGGGCCAGTCCTTCGCCGTCAACGCCACCTTCAGCCCGACCGCCGTCGGCTTCCTCTCCGTC
GACCTGCTCGTCAACTCCACCAACGCCGCCGCCGGCTACAGCGCCGCCACCCACGCCCGCCTGACCGGCACCGGC
CGCAGCCCCGGCGCCCTGCTGGCCCTCAGCCCCAACACCATCTCCTTCCAGGGCGTCGTCACCGGCCAGGACCCG
GCCGGCGTGTCCGAGAGCCTCATCATCAGCAACCGCGGCAACGCGCCCCTGACCGTCCGCTCCGTCCTCGTCTCG
GCCGACAACGCCACCGGCCCGCCGCGGCCGTGGGCCGGCCCGGCCGACCTCGTCGTCGGCAAGTTCACCCTTCAA
AAGGTGCCGGCCACCGTCGCCGCCAACGCCGCCGTCACCGTCGCCGTCCTCTTCAACTCGTCCGCCAGCGGCACC
TTCTCCGGCTCGGTCCGCTTCGTCACTGACGGCGGCAACGGCACCGTCTCCATCTACGGCTCCTCCGGGCCCGCC
GCCGCCGCCCTGATCGAGTTCCAGACGACCGACGGCGCCGGCTGGGTCCCGTACCGGCCCGGCACGCCCTTCAGC
TTCGGCAACGTGACGGAGAACACGGCGCGGGCGCTCAAGCTGCGCGTCACCAACAGCGCGGCCGCCGGCGGCGTC
CGCCTGTCGCTGACGGTGTCGAAGCCGCCCTTCGGCGTCGCCGGCCTCATCCGGGCCGCCAACCAGGTCGACCTG
GCCGAGGGCTCGTCGCTGGCGCCCGGCGAGAGCGGCACGGCCGTGCTGACGTGCGCCGCGCCCAAGTCGCAGTGG
AACGTGGCCGCCTACAACGGCACGGCCCAGTGGACCATCAACACCAACGACCCGGCCATGGGCAAGCAGTTCATC
CAGTTCGCCTGCAACGCCGTCGCCGAGCAGGCGCCGCCGCTGCTGCCCGGCGGCCAGGGCCAGTACCGCTACGTC
GGCTGCTTCAAGGACAACACGCCCGGCCGCCAGCTCCCGAACCAGCTGGTGGCGGACGACAAGCTGGCCAACGCC
CAGTGCATCGCCGCCTGCGCCAAGGCCGGCTACGCCTTCTGCGGCACCGAGTACCTGCGCGAGTGCTGGGCCGGG
AACCAGCTGCCGCTGCAAAAGGTCGACGAGGCCAACTGCAACTACAACTGCGCCGGCGACGTCAACCAGATCTGC
GGCGGCAACGGCGTCAACGACGCGGCCGGCGGCACCTTCATGTCGCTCTTCGCCGACTCGCTGCAGTGGGACGGC
AACTACACCCGGCCCCCGGTCTCCGGGCCGGCCGTGAACCCGGGCGTCTCCGGCTTCGCCAGCATCGGCTGCTAC
ACCGAACCCAGCAACGCCCGCGCGCTGCCCAACGGCGTCAACACGGACAAGCGCACCGTCGCGGCCTGCGTCAAC
GCCTGCAAGGCCGCCGCCTACTCCTTTGCCGGCATGGAATACGGAGGCGAGTGCTGGTGTGGCAACGCCCTGACT
ACCGGCTCCGTCTCGGCCCCAGACGCCGACTGCGGCATGACCTGCAACGACAACTCGACCGAATACTGCGGCGGG
CCGTCGAGACTCAACGTCTACAGGCTCGGGACCCAGCTGCCGAGCTCGTCGTCGTCGTCGTCGTCGTCAACCACC
GGCCCGTCCTCGAGCACCGGCTCCGCGCCGTCGACCTCCCCGACCTCCCCGACCAGCAGCAGCTCGAGCTCCGCC
ACACCGACACCGACCGGCCCGGCCGTCAAGAACGCCGTCGGGCGCTACCTGTTCCAGGGCTGCTGGACCGAGGCC
ACCAACAGCCGGGCCCTGCTGGGCAACGCCTATGCCGACGACAAGATGACGCTCGAGACGTGCGCCAAGTTCTGC
GACGGCTTCAAGTACTTCGCCGCCGAGTACGGCCGCGAGTGCTACTGCGGCAACGAGCTGCAGGCCGGCAGTGCC
CGGGCCGCCGCCCAGGCCGACTGCTCCTTTCCCTGCGCCGGCGACGGCTCCGAGTACTGCGGCGCCGGCAACAGG
CTCCAGCTGTACCGCCTGGCCGACTCGGTGCCGACGGCGTCGTCGGGCCCGTCCCTGGCCGGCGGCGGCGGCGCC
GACTCGACCTCGAGCGCCGCTGTTTCGACCTCCTGCCTCGCCCTCCTCTTCCGCCACTCTGCCCTCGAGTATCTC
GGCAGGCCAGAACTCAACCTCGGTGGCCGCTACCTCGACGTCTACGGGCCAGGCTTCGTCCGCGTCTGCCTCTGT
GCAGTCCTCGGCCTCTTCAGGCGCCAGCTCGGCTGGGCCGTCTTCTACTCTGACAACGGCAATCCTCTCGGTCAC
TTCGGCGTCTTCCTCGACAGCCGCGGCCTCCTCCTCTTCTTCCTCCTCCTCTTCCTCCTCCTCCTCTTCCTCTTC
GGCCCAGCAAACCTCTTCTTCGGCCGCGGCCAGCAGCTCGGGAACCCGGGCTGCCAGCTCCTTGTCAACGACTGC
CACTCCTTCCACCACACCAAGCACATCTCCCACCGCATCATCCTCGAGTCCAGCGAGCCAGACCCCCGGCACCTC
GGGATCGAGCTCACGACGGCCTCGACATCGGCGTCGGCCACCCCAACCGGCCCCATAGTCTGGCCCGGCAACGCC
AACTTCACCTTCTACTCGTGCGTCTCGGAGCCGTCCAACGGTCGTCTTCTGGACCTCCAGATGCTCAACGACGCC
AAGAACATGACCATCGACAGCTGCCTGAGAAAGTGCTACAACTACCAGTGGGCGGGCGTCGAGTACGGCCAAGAG
TGCTGGTGCGGGAACAAGCTCAACCTGGCGGGCAACGACGGCGCCACGCCGGGCAAGAACGTGACCAAGACGGAG
TGCAACATGATATGCCCCGGGGACAAGAACGTCTACTGCGGTGCCGGCGTCAGGCTGAGTCTATACTCGAACAAT
GCGACGACTACGCGGTGA
Transcript >Hirsu2|10134
ATGAAGCCCCTGGGCAGCGGGTCACTGCTGGTGTCGGCCCTGGTGGGCCTGGCCAGCGGCCTCGGCTCGACCGAT
ACGACGACCTGGGGAGGGGACAACTCGCGTACGGGATTCGAGACGAACCACAACATGGACCCGGCCGTGGTGGGC
AGCCCGCAGTTCGGACAGCTCTTCAGCACGCTGCTGCCCGGCAGCTTCGCCGGCCAGCCGGAGCAGATCTACTCG
CAGCCGCTGGTGTACACGCCGAGCGGCGGCAGCCGGCAGTTCGTGTACGTGGCGACGACGCTCAACAACGTGTAC
AAGCTGGACGCCAAGACGGGGGCGGTGGTGGCGTCGCGCAAGCTGCACATACCCTTCCAGACGGCCGACCTGGAC
GGCTGCGTCGACATCAACCCGGCGGTCGGGGTGACGTCGACGGGCGTCATCGACCCGGCCACCGACACGCTCTAC
CTGACGGCCAAGACGTACGCGGACCAGAGCCAGACGGAGCGGCCGCAGGGCCGGCCGGCCGGGCGGTACTACCTG
CACGCGCTCGACGCCGGCGACCTGACGGAGCGGGCCAACTTCCCGGTCGACCTGGAGGGCACGGTGGCGCGCAAC
AACGCGAACCGGACGTTCACGGCCGGCATCCACCTGCAGCGGCCGGCGCTGCTGCTGAGCGGGCAGTACGTGTAC
GCCGGGTTCGCCTCGCACTGCGTGCAGTACAACTTCACCGGCTGGATCATGGGCTGGGACAAGGCCAGCGGGCGG
ACGGTGGAGCGGCTGACGACGGAGGGCGCCGGCGTGCCGGACGCGGTCAAGGGCGGCGGCATCTGGATGTCGGGC
GGCGGCATCTCGTCCGACGACGCCGGCTCGCTCTTCCTCGGCACCGGCAACGGCTACGCGTCGCAGCTCAGCAAC
ATCCCGGTGCGCGGCTACGCGCCGCCCAGCTCGCTCGAGGAGGCGGCGCTGCACCTGACGATGCAGGCCGACGGC
AGCCTCAGCCTCGTCGACTTCTTCATGCCGTGGGAGAAGCAGGCGCTGGACGGGGGCGACAAGGACCTGGGCACG
ACGCCGCTGGCGCTGCTGCCGCGCCAGTTCGCCTGCGGCGACGTCCGCCGCATCGGCGTCATCACCGGCAAGACG
GGCAAGACGTACTGGCTCAACCTCGACAGCCTGGGCGGCTACCGCAACGGCCGCGACGGGCTCGACGACGTCGTC
CAGGTCTACCAGAACGAGAACTCGGTCTACAGCGGCGCCGGCGTCTACCCGCTCGAGGGCGGCTACGTCTACATC
AACGTCATCCAGAACCCGACGGCCGTCTTCAAGTTCTCGTGCAGCGCCGCCGGCGTCCCGGCCTTCACCAAGGTC
GCCGTCTCGCCCTCGGCCAACGCCTACATCCTCGGCGTCAGCCACGGCGCCGTCACCGCCCTGCCCGGCCAGGAC
GGCACCGGCCTGCTCTGGGTCACCGACGTCCAGGGGCTCAACCTGCGCATCTACGCCGCCGTCCCGCGCGACGGC
CTGCTGACCATGCTCAACTCGTTCAACGTCCCGGGCGTCACCAAGTTCGCCCGGCCCGTCTTCGGCGACGGCATC
GCCTACGTCGGCACCACCACCGGCTACCTCTACGCCTTCGGCTCGCCCGTCAACCCGCCCCTCAACTGCTCCTCG
CCCGTCGACTTCGGCACCGTCGACCTCGGCTCCGCCGCCCCCGGCCCGGCCCGGCCCGTCACCTGCCGCGCCAAC
GTCGGCCTGACCGTCACCGGCCTCGGCCTCGGCGACCGCCGCGACTTCGCCATCGCCTCCGCGCCCGCCCTGCCG
CTGCAGCTGGCCCAGGGCCAGTCCTTCGCCGTCAACGCCACCTTCAGCCCGACCGCCGTCGGCTTCCTCTCCGTC
GACCTGCTCGTCAACTCCACCAACGCCGCCGCCGGCTACAGCGCCGCCACCCACGCCCGCCTGACCGGCACCGGC
CGCAGCCCCGGCGCCCTGCTGGCCCTCAGCCCCAACACCATCTCCTTCCAGGGCGTCGTCACCGGCCAGGACCCG
GCCGGCGTGTCCGAGAGCCTCATCATCAGCAACCGCGGCAACGCGCCCCTGACCGTCCGCTCCGTCCTCGTCTCG
GCCGACAACGCCACCGGCCCGCCGCGGCCGTGGGCCGGCCCGGCCGACCTCGTCGTCGGCAAGTTCACCCTTCAA
AAGGTGCCGGCCACCGTCGCCGCCAACGCCGCCGTCACCGTCGCCGTCCTCTTCAACTCGTCCGCCAGCGGCACC
TTCTCCGGCTCGGTCCGCTTCGTCACTGACGGCGGCAACGGCACCGTCTCCATCTACGGCTCCTCCGGGCCCGCC
GCCGCCGCCCTGATCGAGTTCCAGACGACCGACGGCGCCGGCTGGGTCCCGTACCGGCCCGGCACGCCCTTCAGC
TTCGGCAACGTGACGGAGAACACGGCGCGGGCGCTCAAGCTGCGCGTCACCAACAGCGCGGCCGCCGGCGGCGTC
CGCCTGTCGCTGACGGTGTCGAAGCCGCCCTTCGGCGTCGCCGGCCTCATCCGGGCCGCCAACCAGGTCGACCTG
GCCGAGGGCTCGTCGCTGGCGCCCGGCGAGAGCGGCACGGCCGTGCTGACGTGCGCCGCGCCCAAGTCGCAGTGG
AACGTGGCCGCCTACAACGGCACGGCCCAGTGGACCATCAACACCAACGACCCGGCCATGGGCAAGCAGTTCATC
CAGTTCGCCTGCAACGCCGTCGCCGAGCAGGCGCCGCCGCTGCTGCCCGGCGGCCAGGGCCAGTACCGCTACGTC
GGCTGCTTCAAGGACAACACGCCCGGCCGCCAGCTCCCGAACCAGCTGGTGGCGGACGACAAGCTGGCCAACGCC
CAGTGCATCGCCGCCTGCGCCAAGGCCGGCTACGCCTTCTGCGGCACCGAGTACCTGCGCGAGTGCTGGGCCGGG
AACCAGCTGCCGCTGCAAAAGGTCGACGAGGCCAACTGCAACTACAACTGCGCCGGCGACGTCAACCAGATCTGC
GGCGGCAACGGCGTCAACGACGCGGCCGGCGGCACCTTCATGTCGCTCTTCGCCGACTCGCTGCAGTGGGACGGC
AACTACACCCGGCCCCCGGTCTCCGGGCCGGCCGTGAACCCGGGCGTCTCCGGCTTCGCCAGCATCGGCTGCTAC
ACCGAACCCAGCAACGCCCGCGCGCTGCCCAACGGCGTCAACACGGACAAGCGCACCGTCGCGGCCTGCGTCAAC
GCCTGCAAGGCCGCCGCCTACTCCTTTGCCGGCATGGAATACGGAGGCGAGTGCTGGTGTGGCAACGCCCTGACT
ACCGGCTCCGTCTCGGCCCCAGACGCCGACTGCGGCATGACCTGCAACGACAACTCGACCGAATACTGCGGCGGG
CCGTCGAGACTCAACGTCTACAGGCTCGGGACCCAGCTGCCGAGCTCGTCGTCGTCGTCGTCGTCGTCAACCACC
GGCCCGTCCTCGAGCACCGGCTCCGCGCCGTCGACCTCCCCGACCTCCCCGACCAGCAGCAGCTCGAGCTCCGCC
ACACCGACACCGACCGGCCCGGCCGTCAAGAACGCCGTCGGGCGCTACCTGTTCCAGGGCTGCTGGACCGAGGCC
ACCAACAGCCGGGCCCTGCTGGGCAACGCCTATGCCGACGACAAGATGACGCTCGAGACGTGCGCCAAGTTCTGC
GACGGCTTCAAGTACTTCGCCGCCGAGTACGGCCGCGAGTGCTACTGCGGCAACGAGCTGCAGGCCGGCAGTGCC
CGGGCCGCCGCCCAGGCCGACTGCTCCTTTCCCTGCGCCGGCGACGGCTCCGAGTACTGCGGCGCCGGCAACAGG
CTCCAGCTGTACCGCCTGGCCGACTCGGTGCCGACGGCGTCGTCGGGCCCGTCCCTGGCCGGCGGCGGCGGCGCC
GACTCGACCTCGAGCGCCGCTGTTTCGACCTCCTGCCTCGCCCTCCTCTTCCGCCACTCTGCCCTCGAGTATCTC
GGCAGGCCAGAACTCAACCTCGGTGGCCGCTACCTCGACGTCTACGGGCCAGGCTTCGTCCGCGTCTGCCTCTGT
GCAGTCCTCGGCCTCTTCAGGCGCCAGCTCGGCTGGGCCGTCTTCTACTCTGACAACGGCAATCCTCTCGGTCAC
TTCGGCGTCTTCCTCGACAGCCGCGGCCTCCTCCTCTTCTTCCTCCTCCTCTTCCTCCTCCTCCTCTTCCTCTTC
GGCCCAGCAAACCTCTTCTTCGGCCGCGGCCAGCAGCTCGGGAACCCGGGCTGCCAGCTCCTTGTCAACGACTGC
CACTCCTTCCACCACACCAAGCACATCTCCCACCGCATCATCCTCGAGTCCAGCGAGCCAGACCCCCGGCACCTC
GGGATCGAGCTCACGACGGCCTCGACATCGGCGTCGGCCACCCCAACCGGCCCCATAGTCTGGCCCGGCAACGCC
AACTTCACCTTCTACTCGTGCGTCTCGGAGCCGTCCAACGGTCGTCTTCTGGACCTCCAGATGCTCAACGACGCC
AAGAACATGACCATCGACAGCTGCCTGAGAAAGTGCTACAACTACCAGTGGGCGGGCGTCGAGTACGGCCAAGAG
TGCTGGTGCGGGAACAAGCTCAACCTGGCGGGCAACGACGGCGCCACGCCGGGCAAGAACGTGACCAAGACGGAG
TGCAACATGATATGCCCCGGGGACAAGAACGTCTACTGCGGTGCCGGCGTCAGGCTGAGTCTATACTCGAACAAT
GCGACGACTACGCGGTGA
Gene >Hirsu2|10134
ATGAAGCCCCTGGGCAGCGGGTCACTGCTGGTGTCGGCCCTGGTGGGCCTGGCCAGCGGCCTCGGCTCGACCGAT
ACGACGACCTGGGGAGGGGACAACTCGCGTACGGGATTCGAGACGTGAGGAACAGCATCATGATCCCCCCCCCCC
CTCTTGTGTCCCCCATGTTGCTGACCTCGAGCCTCCGCCTCCCGGCCGGGCAGGAACCACAACATGGACCCGGCC
GTGGTGGGCAGCCCGCAGTTCGGACAGCTCTTCAGCACGCTGCTGCCCGGCAGCTTCGCCGGCCAGCCGGAGCAG
ATCTACTCGCAGCCGCTGGTGTACACGCCGAGCGGCGGCAGCCGGCAGTTCGTGTACGTGGCGACGACGCTCAAC
AACGTGTACAAGCTGGACGCCAAGACGGGGGCGGTGGTGGCGTCGCGCAAGCTGCACATACCCTTCCAGACGGCC
GACCTGGACGGCTGCGTCGACATCAACCCGGCGGTCGGGGTGACGTCGACGGGCGTCATCGACCCGGCCACCGAC
ACGCTCTACCTGACGGCCAAGACGTACGCGGACCAGAGCCAGACGGAGCGGCCGCAGGGCCGGCCGGCCGGGCGG
TACTACCTGCACGCGCTCGACGCCGGCGACCTGACGGAGCGGGCCAACTTCCCGGTCGACCTGGAGGGCACGGTG
GCGCGCAACAACGCGAACCGGACGTTCACGGCCGGCATCCACCTGCAGCGGCCGGCGCTGCTGCTGAGCGGGCAG
TACGTGTACGCCGGGTTCGCCTCGCACTGCGTGCAGTACAACTTCACCGGCTGGATCATGGGCTGGGACAAGGCC
AGCGGGCGGACGGTGGAGCGGCTGACGACGGAGGGCGCCGGCGTGCCGGACGCGGTCAAGGGCGGCGGCATCTGG
ATGTCGGGCGGCGGCATCTCGTCCGACGACGCCGGCTCGCTCTTCCTCGGCACCGGCAACGGCTACGCGTCGCAG
CTCAGCAACATCCCGGTGCGCGGCTACGCGCCGCCCAGCTCGCTCGAGGAGGCGGCGCTGCACCTGACGATGCAG
GCCGACGGCAGCCTCAGCCTCGTCGACTTCTTCATGCCGTGGGAGAAGCAGGCGCTGGACGGGGGCGACAAGGAC
CTGGGCACGACGCCGCTGGCGCTGCTGCCGCGCCAGTTCGCCTGCGGCGACGTCCGCCGCATCGGCGTCATCACC
GGCAAGACGGGCAAGACGTACTGGCTCAACCTCGACAGCCTGGGCGGCTACCGCAACGGCCGCGACGGGCTCGAC
GACGTCGTCCAGGTCTACCAGAACGAGAACTCGGTCTACAGCGGCGCCGGCGTCTACCCGCTCGAGGGCGGCTAC
GTCTACATCAACGTCATCCAGAACCCGACGGCCGTCTTCAAGTTCTCGTGCAGCGCCGCCGGCGTCCCGGCCTTC
ACCAAGGTCGCCGTCTCGCCCTCGGCCAACGCCTACATCCTCGGCGTCAGCCACGGCGCCGTCACCGCCCTGCCC
GGCCAGGACGGCACCGGCCTGCTCTGGGTCACCGACGTCCAGGGGCTCAACCTGCGCATCTACGCCGCCGTCCCG
CGCGACGGCCTGCTGACCATGCTCAACTCGTTCAACGTCCCGGGCGTCACCAAGTTCGCCCGGCCCGTCTTCGGC
GACGGCATCGCCTACGTCGGCACCACCACCGGCTACCTCTACGCCTTCGGCTCGCCCGTCAACCCGCCCCTCAAC
TGCTCCTCGCCCGTCGACTTCGGCACCGTCGACCTCGGCTCCGCCGCCCCCGGCCCGGCCCGGCCCGTCACCTGC
CGCGCCAACGTCGGCCTGACCGTCACCGGCCTCGGCCTCGGCGACCGCCGCGACTTCGCCATCGCCTCCGCGCCC
GCCCTGCCGCTGCAGCTGGCCCAGGGCCAGTCCTTCGCCGTCAACGCCACCTTCAGCCCGACCGCCGTCGGCTTC
CTCTCCGTCGACCTGCTCGTCAACTCCACCAACGCCGCCGCCGGCTACAGCGCCGCCACCCACGCCCGCCTGACC
GGCACCGGCCGCAGCCCCGGCGCCCTGCTGGCCCTCAGCCCCAACACCATCTCCTTCCAGGGCGTCGTCACCGGC
CAGGACCCGGCCGGCGTGTCCGAGAGCCTCATCATCAGCAACCGCGGCAACGCGCCCCTGACCGTCCGCTCCGTC
CTCGTCTCGGCCGACAACGCCACCGGCCCGCCGCGGCCGTGGGCCGGCCCGGCCGACCTCGTCGTCGGCAAGTTC
ACCCTTCAAAAGGTGCCGGCCACCGTCGCCGCCAACGCCGCCGTCACCGTCGCCGTCCTCTTCAACTCGTCCGCC
AGCGGCACCTTCTCCGGCTCGGTCCGCTTCGTCACTGACGGCGGCAACGGCACCGTCTCCATCTACGGCTCCTCC
GGGCCCGCCGCCGCCGCCCTGATCGAGTTCCAGACGACCGACGGCGCCGGCTGGGTCCCGTACCGGCCCGGCACG
CCCTTCAGCTTCGGCAACGTGACGGAGAACACGGCGCGGGCGCTCAAGCTGCGCGTCACCAACAGCGCGGCCGCC
GGCGGCGTCCGCCTGTCGCTGACGGTGTCGAAGCCGCCCTTCGGCGTCGCCGGCCTCATCCGGGCCGCCAACCAG
GTCGACCTGGCCGAGGGCTCGTCGCTGGCGCCCGGCGAGAGCGGCACGGCCGTGCTGACGTGCGCCGCGCCCAAG
TCGCAGTGGAACGTGGCCGCCTACAACGGCACGGCCCAGTGGACCATCAACACCAACGACCCGGCCATGGGCAAG
CAGTTCATCCAGTTCGCCTGCAACGCCGTCGCCGAGCAGGCGCCGCCGCTGCTGCCCGGCGGCCAGGGCCAGTAC
CGCTACGTCGGCTGCTTCAAGGACAACACGCCCGGCCGCCAGCTCCCGAACCAGCTGGTGGCGGACGACAAGCTG
GCCAACGCCCAGTGCATCGCCGCCTGCGCCAAGGCCGGCTACGCCTTCTGCGGCACCGAGTACCTGCGCGAGTGC
TGGGCCGGGAACCAGCTGCCGCTGCAAAAGGTCGACGAGGCCAACTGCAACTACAACTGCGCCGGCGACGTCAAC
CAGATCTGCGGCGGCAACGGCGTCAACGACGCGGCCGGCGGCACCTTCATGTCGCTCTTCGCCGACTCGCTGCAG
TGGGACGGCAACTACACCCGGCCCCCGGTCTCCGGGCCGGCCGTGAACCCGGGCGTCTCCGGCTTCGCCAGCATC
GGCTGCTACACCGAACCCAGCAACGCCCGCGCGCTGCCCAACGGCGTCAACACGGACAAGCGCACCGTCGCGGCC
TGCGTCAACGCCTGCAAGGCCGCCGCCTACTCCTTTGCCGGCATGGAATACGGAGGCGAGGTAGGGACTGTTTGC
CAGTGAGAGATCGTGAGGGACCCAGTCTTGCTGACGACTTCTTCTTCTTCTTCTTCTTCTTCAAGTGCTGGTGTG
GCAACGCCCTGACTACCGGCTCCGTCTCGGCCCCAGACGCCGACTGCGGCATGACCTGCAACGGTAAGGACTTCT
TCTCCTCGAGATAGGCCTCTCCAACCTCGTGCTGACGGGACTTGGCAGACAACTCGACCGAATACTGCGGCGGGC
CGTCGAGACTCAACGTCTACAGGCTCGGGACCCAGCTGCCGAGCTCGTCGTCGTCGTCGTCGTCGTCAACCACCG
GCCCGTCCTCGAGCACCGGCTCCGCGCCGTCGACCTCCCCGACCTCCCCGACCAGCAGCAGCTCGAGCTCCGCCA
CACCGACACCGACCGGCCCGGCCGTCAAGAACGCCGTCGGGCGCTACCTGTTCCAGGGCTGCTGGACCGAGGCCA
CCAACAGCCGGGCCCTGCTGGGCAACGCCTATGCCGACGACAAGATGACGCTCGAGACGTGCGCCAAGTTCTGCG
ACGGCTTCAAGTACTTCGCCGCCGAGTACGGCCGCGAGTGCTACTGCGGCAACGAGCTGCAGGCCGGCAGTGCCC
GGGCCGCCGCCCAGGCCGACTGCTCCTTTCCCTGCGCCGGCGACGGCTCCGAGTACTGCGGCGCCGGCAACAGGC
TCCAGCTGTACCGCCTGGCCGACTCGGTGCCGACGGCGTCGTCGGGCCCGTCCCTGGCCGGCGGCGGCGGCGCCG
ACTCGACCTCGAGCGCCGCTGTTTCGACCTCCGTGAGCTCGGCTGCTACCTCTGCCGCCAACCAGTCCAGCGTCA
CGACCAGCAGTGCCTCGCCCTCCTCTTCCGCCACTCTGCCCTCGAGTATCTCGGCAGGCCAGAACTCAACCTCGG
TGGCCGCTACCTCGACGTCTACGGGCCAGGCTTCGTCCGCGTCTGCCTCTGTGCAGTCCTCGGCCTCTTCAGGCG
CCAGCTCGGCTGGGCCGTCTTCTACTCTGACAACGGCAATCCTGTCCACATCTTCGCGCTCGTCTTCGGCGTCCC
TCATTAGCTCGGTCACTTCGGCGTCTTCCTCGACAGCCGCGGCCTCCTCCTCTTCTTCCTCCTCCTCTTCCTCCT
CCTCCTCTTCCTCTTCGGCCCAGCAAACCTCTTCTTCGGCCGCGGCCAGCAGCTCGGGAACCCGGGCTGCCAGCT
CCTTGTCAACGACTGCCACTCCTTCCACCACACCAAGCACATCTCCCACCGCATCATCCTCGAGTCCAGCGAGCC
AGACCCCCGGCACCTCGGGATCGAGCTCGTCAGATAAGCCAAGCGCTTCGTCCGCGACGGCAACGTCCTCGACGA
AGACGACGGCCTCGACATCGGCGTCGGCCACCCCAACCGGCCCCATAGTCTGGCCCGGCAACGCCAACTTCACCT
TCTACTCGTGCGTCTCGGAGCCGTCCAACGGTCGTCTTCTGGACCTCCAGATGCTCAACGACGCCAAGAACATGA
CCATCGACAGCTGCCTGAGAAAGTGCTACAACTACCAGTGGGCGGGCGTCGAGTACGGCCAAGAGTGCTGGTGCG
GGAACAAGCTCAACCTGGCGGGCAACGACGGCGCCACGCCGGGCAAGAACGTGACCAAGACGGAGTGCAACATGA
TATGCCCCGGGGACAAGAACGTCTACTGCGGTGCCGGCGTCAGGCTGAGTCTATACTCGAACAATGCGACGACTA
CGCGGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail