Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1013
Gene name
LocationContig_121:5144..5750
Strand-
Gene length (bp)606
Transcript length (bp)489
Coding sequence length (bp)489
Protein length (aa) 163

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10276 zf-CHCC Zinc-finger domain 5.2E-14 107 142

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5AUI1|LBSA_EMENI Lactobacillus shifted protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=lbsA PE=1 SV=1 54 161 1.0E-54
sp|P52504|NDUS6_RAT NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial OS=Rattus norvegicus GN=Ndufs6 PE=3 SV=1 92 147 1.0E-14
sp|P52503|NDUS6_MOUSE NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial OS=Mus musculus GN=Ndufs6 PE=1 SV=2 92 147 1.0E-14
sp|P23934|NDUS6_BOVIN NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial OS=Bos taurus GN=NDUFS6 PE=1 SV=2 92 147 4.0E-14
sp|Q0MQH5|NDUS6_PONPY NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial OS=Pongo pygmaeus GN=NDUFS6 PE=2 SV=1 92 147 8.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5AUI1|LBSA_EMENI Lactobacillus shifted protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=lbsA PE=1 SV=1 54 161 1.0E-54
sp|P52504|NDUS6_RAT NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial OS=Rattus norvegicus GN=Ndufs6 PE=3 SV=1 92 147 1.0E-14
sp|P52503|NDUS6_MOUSE NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial OS=Mus musculus GN=Ndufs6 PE=1 SV=2 92 147 1.0E-14
sp|P23934|NDUS6_BOVIN NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial OS=Bos taurus GN=NDUFS6 PE=1 SV=2 92 147 4.0E-14
sp|Q0MQH5|NDUS6_PONPY NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial OS=Pongo pygmaeus GN=NDUFS6 PE=2 SV=1 92 147 8.0E-14
sp|Q0MQH7|NDUS6_PANTR NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial OS=Pan troglodytes GN=NDUFS6 PE=2 SV=1 92 147 9.0E-14
sp|O75380|NDUS6_HUMAN NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial OS=Homo sapiens GN=NDUFS6 PE=1 SV=1 92 147 9.0E-14
sp|Q0MQH6|NDUS6_GORGO NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial OS=Gorilla gorilla gorilla GN=NDUFS6 PE=2 SV=1 92 148 2.0E-13
sp|Q4R5X8|NDUS6_MACFA NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial OS=Macaca fascicularis GN=NDUFS6 PE=2 SV=1 92 147 2.0E-12
sp|Q19724|NDUS6_CAEEL Probable NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial OS=Caenorhabditis elegans GN=nduf-6 PE=3 SV=1 74 149 2.0E-11
sp|Q9M9M6|NDUS6_ARATH NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial OS=Arabidopsis thaliana GN=At3g03070 PE=3 SV=1 91 147 3.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1013
MADSRLRPIGLVVRSLRVPQRAFATSGRLFEAAVPANAKTETAVQDVQPKEVAQAPNRADIWSRSQRPRATAMTG
PRFEQTDFDLQPQPLSAMELIHKQPVRWTHDRIATCEGGGGPAGHPKIFINTDKPEIATCNYCGLPFANEHHRKH
LESLPVTSYPLS*
Coding >Hirsu2|1013
ATGGCCGACTCTCGGTTACGGCCAATCGGCCTCGTCGTGCGCAGCCTGCGCGTTCCTCAACGAGCATTCGCCACA
TCGGGGCGGCTCTTCGAGGCTGCCGTACCCGCCAACGCCAAGACCGAAACCGCCGTCCAAGATGTGCAGCCCAAG
GAAGTTGCCCAGGCTCCCAATCGAGCGGACATCTGGTCCCGCAGCCAGAGGCCGCGAGCCACGGCCATGACGGGC
CCCCGATTCGAGCAAACAGACTTCGACCTGCAGCCCCAACCTCTGTCCGCGATGGAGCTCATACACAAGCAGCCG
GTCCGGTGGACGCACGACCGAATCGCGACTTGCGAGGGTGGCGGTGGTCCTGCCGGACACCCCAAGATCTTCATC
AATACCGACAAGCCGGAGATCGCCACCTGCAACTACTGCGGCTTGCCCTTTGCCAATGAACACCACAGGAAGCAC
CTCGAATCCCTTCCCGTGACCTCCTACCCGTTATCGTGA
Transcript >Hirsu2|1013
ATGGCCGACTCTCGGTTACGGCCAATCGGCCTCGTCGTGCGCAGCCTGCGCGTTCCTCAACGAGCATTCGCCACA
TCGGGGCGGCTCTTCGAGGCTGCCGTACCCGCCAACGCCAAGACCGAAACCGCCGTCCAAGATGTGCAGCCCAAG
GAAGTTGCCCAGGCTCCCAATCGAGCGGACATCTGGTCCCGCAGCCAGAGGCCGCGAGCCACGGCCATGACGGGC
CCCCGATTCGAGCAAACAGACTTCGACCTGCAGCCCCAACCTCTGTCCGCGATGGAGCTCATACACAAGCAGCCG
GTCCGGTGGACGCACGACCGAATCGCGACTTGCGAGGGTGGCGGTGGTCCTGCCGGACACCCCAAGATCTTCATC
AATACCGACAAGCCGGAGATCGCCACCTGCAACTACTGCGGCTTGCCCTTTGCCAATGAACACCACAGGAAGCAC
CTCGAATCCCTTCCCGTGACCTCCTACCCGTTATCGTGA
Gene >Hirsu2|1013
ATGGCCGACTCTCGGTTACGGCCAATCGGCCTCGTCGTGCGCAGCCTGCGCGTTCCTCAACGAGCATTCGCCACA
TCGGGGCGGCTCTTCGAGGCTGCCGTACCCGCCAACGCCAAGACCGAAACCGCCGTCCAAGATGTGCAGCCCAAG
GAAGTTGCCCAGGCTCCCAATCGAGCGGACATCTGGTCCCGCAGCCAGAGGCCGCGAGCCACGGCCATGACGGGC
CCCCGATTCGAGCAAACAGACTTCGACCTGCAGGTGGGCGCGGCCAGCCAGCCTGCGGACATGGCTCGGGCAATG
CTGACGGCGTGATCAGCCCCAACCTCTGTCCGCGATGGAGCTCATACACAAGCAGCCGGTCCGGTGGACGCACGA
CCGAATCGCGACTTGCGAGGGTGGCGGTGGTCCTGCCGGACACCCCAAGATCTTCATCAATACCGACAAGCCGGA
GATCGCCACCTGCAACTACTGCGGCTTGCCCTTTGTACGTCACAATCACGGGGGGCAGGGCCCATCAAGAACGAA
ATGTTGACCATTTTAAAGGCCAATGAACACCACAGGAAGCACCTCGAATCCCTTCCCGTGACCTCCTACCCGTTA
TCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail