Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10128
Gene name
LocationContig_793:1572..3922
Strand-
Gene length (bp)2350
Transcript length (bp)2229
Coding sequence length (bp)2229
Protein length (aa) 743

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02990 EMP70 Endomembrane protein 70 7.5E-195 55 699

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4KLL4|TM9S4_RAT Transmembrane 9 superfamily member 4 OS=Rattus norvegicus GN=Tm9sf4 PE=2 SV=1 12 742 1.0E-142
sp|Q8BH24|TM9S4_MOUSE Transmembrane 9 superfamily member 4 OS=Mus musculus GN=Tm9sf4 PE=1 SV=1 12 742 2.0E-141
sp|Q92544|TM9S4_HUMAN Transmembrane 9 superfamily member 4 OS=Homo sapiens GN=TM9SF4 PE=1 SV=2 12 742 3.0E-141
sp|Q5RDY2|TM9S4_PONAB Transmembrane 9 superfamily member 4 OS=Pongo abelii GN=TM9SF4 PE=2 SV=1 12 742 3.0E-141
sp|A5D7E2|TM9S4_BOVIN Transmembrane 9 superfamily member 4 OS=Bos taurus GN=TM9SF4 PE=2 SV=2 11 742 1.0E-139
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4KLL4|TM9S4_RAT Transmembrane 9 superfamily member 4 OS=Rattus norvegicus GN=Tm9sf4 PE=2 SV=1 12 742 1.0E-142
sp|Q8BH24|TM9S4_MOUSE Transmembrane 9 superfamily member 4 OS=Mus musculus GN=Tm9sf4 PE=1 SV=1 12 742 2.0E-141
sp|Q92544|TM9S4_HUMAN Transmembrane 9 superfamily member 4 OS=Homo sapiens GN=TM9SF4 PE=1 SV=2 12 742 3.0E-141
sp|Q5RDY2|TM9S4_PONAB Transmembrane 9 superfamily member 4 OS=Pongo abelii GN=TM9SF4 PE=2 SV=1 12 742 3.0E-141
sp|A5D7E2|TM9S4_BOVIN Transmembrane 9 superfamily member 4 OS=Bos taurus GN=TM9SF4 PE=2 SV=2 11 742 1.0E-139
sp|Q8RWW1|TMN10_ARATH Transmembrane 9 superfamily member 10 OS=Arabidopsis thaliana GN=TMN10 PE=2 SV=1 12 742 2.0E-133
sp|Q9C720|TMN6_ARATH Transmembrane 9 superfamily member 6 OS=Arabidopsis thaliana GN=TMN6 PE=2 SV=1 4 742 6.0E-133
sp|Q9LIC2|TMN7_ARATH Transmembrane 9 superfamily member 7 OS=Arabidopsis thaliana GN=TMN7 PE=2 SV=1 23 742 7.0E-130
sp|Q55FP0|PHG1A_DICDI Putative phagocytic receptor 1a OS=Dictyostelium discoideum GN=phg1a PE=2 SV=1 12 742 2.0E-125
sp|Q99805|TM9S2_HUMAN Transmembrane 9 superfamily member 2 OS=Homo sapiens GN=TM9SF2 PE=1 SV=1 23 742 2.0E-118
sp|Q66HG5|TM9S2_RAT Transmembrane 9 superfamily member 2 OS=Rattus norvegicus GN=Tm9sf2 PE=2 SV=1 23 742 2.0E-118
sp|P58021|TM9S2_MOUSE Transmembrane 9 superfamily member 2 OS=Mus musculus GN=Tm9sf2 PE=1 SV=1 23 742 8.0E-118
sp|Q5R8Y6|TM9S2_PONAB Transmembrane 9 superfamily member 2 OS=Pongo abelii GN=TM9SF2 PE=2 SV=1 24 742 2.0E-117
sp|Q9FYQ8|TMN11_ARATH Transmembrane 9 superfamily member 11 OS=Arabidopsis thaliana GN=TMN11 PE=2 SV=1 6 742 2.0E-98
sp|F4JRE0|TMN12_ARATH Transmembrane 9 superfamily member 12 OS=Arabidopsis thaliana GN=TMN12 PE=2 SV=1 1 742 2.0E-95
sp|Q9C5N2|TMN9_ARATH Transmembrane 9 superfamily member 9 OS=Arabidopsis thaliana GN=TMN9 PE=2 SV=1 423 742 2.0E-90
sp|F4KIB2|TMN8_ARATH Transmembrane 9 superfamily member 8 OS=Arabidopsis thaliana GN=TMN8 PE=2 SV=1 423 742 2.0E-90
sp|Q04562|TMN2_YEAST Transmembrane 9 superfamily member 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TMN2 PE=1 SV=1 24 742 2.0E-88
sp|Q9Y819|YON8_SCHPO Transmembrane 9 superfamily protein C1105.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1105.08 PE=3 SV=1 17 742 1.0E-84
sp|P32802|TMN1_YEAST Transmembrane 9 superfamily member 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EMP70 PE=1 SV=2 12 742 5.0E-84
sp|P40071|TMN3_YEAST Transmembrane 9 superfamily member 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TMN3 PE=1 SV=1 19 736 1.0E-83
sp|Q9ZPS7|TMN3_ARATH Transmembrane 9 superfamily member 3 OS=Arabidopsis thaliana GN=TMN3 PE=2 SV=1 34 742 3.0E-78
sp|Q940S0|TMN2_ARATH Transmembrane 9 superfamily member 2 OS=Arabidopsis thaliana GN=TMN2 PE=2 SV=1 34 742 4.0E-73
sp|Q5R8F1|TM9S1_PONAB Transmembrane 9 superfamily member 1 OS=Pongo abelii GN=TM9SF1 PE=2 SV=1 15 742 4.0E-67
sp|Q9FHT4|TMN4_ARATH Transmembrane 9 superfamily member 4 OS=Arabidopsis thaliana GN=TMN4 PE=2 SV=1 270 742 3.0E-66
sp|Q940G0|TMN1_ARATH Transmembrane 9 superfamily member 1 OS=Arabidopsis thaliana GN=TMN1 PE=1 SV=1 289 742 3.0E-62
sp|Q54ZW0|PHG1B_DICDI Putative phagocytic receptor 1b OS=Dictyostelium discoideum GN=phg1b PE=2 SV=1 249 742 2.0E-60
sp|Q9ET30|TM9S3_MOUSE Transmembrane 9 superfamily member 3 OS=Mus musculus GN=Tm9sf3 PE=1 SV=1 286 742 2.0E-57
sp|Q9HD45|TM9S3_HUMAN Transmembrane 9 superfamily member 3 OS=Homo sapiens GN=TM9SF3 PE=1 SV=2 286 742 2.0E-57
sp|Q9DBU0|TM9S1_MOUSE Transmembrane 9 superfamily member 1 OS=Mus musculus GN=Tm9sf1 PE=2 SV=2 318 742 5.0E-55
sp|A4IFE9|TM9S1_BOVIN Transmembrane 9 superfamily member 1 OS=Bos taurus GN=TM9SF1 PE=2 SV=1 318 742 8.0E-55
sp|O15321|TM9S1_HUMAN Transmembrane 9 superfamily member 1 OS=Homo sapiens GN=TM9SF1 PE=2 SV=2 318 742 2.0E-54
sp|F4HW17|TMN5_ARATH Transmembrane 9 superfamily member 5 OS=Arabidopsis thaliana GN=TMN5 PE=2 SV=1 270 742 1.0E-46
sp|Q66HF2|TM9S1_RAT Transmembrane 9 superfamily member 1 OS=Rattus norvegicus GN=Tm9sf1 PE=2 SV=1 318 742 3.0E-45
sp|Q7YTA6|PHG1C_DICDI Putative phagocytic receptor 1c OS=Dictyostelium discoideum GN=phg1c PE=2 SV=1 179 742 6.0E-44
sp|F4KIB2|TMN8_ARATH Transmembrane 9 superfamily member 8 OS=Arabidopsis thaliana GN=TMN8 PE=2 SV=1 11 354 1.0E-37
sp|Q9C5N2|TMN9_ARATH Transmembrane 9 superfamily member 9 OS=Arabidopsis thaliana GN=TMN9 PE=2 SV=1 9 354 2.0E-37
sp|Q9DBU0|TM9S1_MOUSE Transmembrane 9 superfamily member 1 OS=Mus musculus GN=Tm9sf1 PE=2 SV=2 15 145 3.0E-12
sp|O15321|TM9S1_HUMAN Transmembrane 9 superfamily member 1 OS=Homo sapiens GN=TM9SF1 PE=2 SV=2 15 145 4.0E-12
sp|A4IFE9|TM9S1_BOVIN Transmembrane 9 superfamily member 1 OS=Bos taurus GN=TM9SF1 PE=2 SV=1 31 145 6.0E-12
sp|Q66HF2|TM9S1_RAT Transmembrane 9 superfamily member 1 OS=Rattus norvegicus GN=Tm9sf1 PE=2 SV=1 31 145 6.0E-12
sp|F4HW17|TMN5_ARATH Transmembrane 9 superfamily member 5 OS=Arabidopsis thaliana GN=TMN5 PE=2 SV=1 30 145 5.0E-11
sp|Q9FHT4|TMN4_ARATH Transmembrane 9 superfamily member 4 OS=Arabidopsis thaliana GN=TMN4 PE=2 SV=1 34 145 5.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0044425 membrane part No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

Domain # Start End Length
1 319 341 22
2 439 461 22
3 476 498 22
4 511 533 22
5 548 570 22
6 600 622 22
7 632 654 22
8 667 689 22
9 704 726 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10128
MVGAWRVGLGGLLSLLLHSSAHAFYIPGWSIKSHKEGVQVPLMVNKVYSDNTQIQYAYYDLPFVCPPTGRHKAAG
GLLSGQSIPLNLGEVLRGDRIKASDMELFMRRDKACILLCTKELSRRDVARTRGLIRDGYVVEWIVDNLPGATSF
VTTDKTRKYYAAGFKLGYAELSPATGRPRYFLHNHHTIVIRYRRASGRAGQRGEYIVVGFEVYPKSIGHDNKRDD
AGCPVDLQHLDGALELSMAANRTDDRDDERSRRAVADAAAAAAESDDDDGDDEVDGASLTIPYTYSVYFREDDSI
DWSRRWDLYFVNQEEGSRIHWLAIVNSLIICALLSSLVMIILAKTIRTDIKGYRDPAAVESGRMKKRRRRARSDK
PPGLLDQGPGSDDHYYDGDGDDDDDDDDGDGGGNDDGESIEALEDVTGWKLLHADVFRKPRFGNLLAPLVGSGMQ
LLFMAVGLVLLSALGVLNPSFRGGFISVGVGLFVFAGLFSGYFSARVFRSFDGVDYRRNALVTALLFPGLTFGLV
FMLNLFVWAQASSTAIPFGTLLAMLLLWLCVQVPLVLAGSYYGYVRAGAWEHPTKTAAAPRPMPRRAWYAGTTQS
VLLAGLIPFAVIFIELLFVFQSVWQDKSGYYYVFGFLAVVLVILAVTVAEVTVVTVYVQLCAENYHWWWQSFLVG
GGSAVWLMAYCLWYYAFKLHISGFVSSMLFFTYSFMACCVYGLLTGTIGFLSAYAFVRRIYGAIKVD*
Coding >Hirsu2|10128
ATGGTCGGCGCTTGGCGAGTCGGCCTGGGCGGCCTGCTTTCCCTCCTGCTGCACTCGTCCGCCCACGCCTTCTAC
ATACCCGGGTGGTCAATCAAGAGCCACAAGGAGGGCGTCCAGGTGCCTCTGATGGTCAACAAGGTCTACTCGGAC
AACACCCAGATACAGTACGCCTACTACGACCTGCCCTTCGTCTGCCCGCCCACCGGCCGCCACAAGGCCGCCGGC
GGCCTGCTGAGCGGCCAGAGCATCCCCCTCAACCTCGGCGAGGTCCTGCGCGGCGACCGCATCAAGGCCTCCGAC
ATGGAGCTCTTCATGCGCAGGGACAAGGCCTGCATCCTGCTCTGCACCAAGGAGCTCTCGCGCCGCGACGTGGCA
CGGACGAGGGGCCTGATCCGCGACGGCTACGTCGTTGAGTGGATCGTCGACAACCTCCCCGGCGCCACCAGCTTC
GTCACGACGGACAAGACGCGCAAGTACTACGCCGCCGGCTTCAAGCTGGGCTACGCCGAGCTCTCGCCCGCCACC
GGCAGGCCGCGCTACTTCCTGCACAACCACCATACCATTGTCATCCGCTACCGCAGGGCCTCGGGCCGCGCCGGC
CAGAGGGGCGAGTACATCGTCGTCGGCTTCGAGGTCTACCCCAAGAGCATCGGCCACGACAACAAGCGGGACGAC
GCCGGCTGCCCCGTCGACCTGCAGCACCTCGACGGCGCGCTCGAGCTCTCCATGGCCGCCAACCGAACCGACGAC
CGCGACGACGAGAGGAGCCGCCGGGCCGTCGCTGATGCTGCCGCCGCCGCCGCCGAGAGCGACGACGACGACGGC
GACGACGAGGTCGACGGCGCCTCCCTCACCATCCCCTACACCTACTCCGTCTACTTCCGCGAGGACGACAGCATC
GACTGGTCGCGCCGTTGGGACCTGTACTTCGTCAACCAAGAGGAGGGGTCGCGCATTCACTGGCTTGCCATTGTC
AACTCTCTCATCATCTGCGCCCTCCTCAGCAGCCTCGTCATGATCATCCTGGCCAAGACGATCCGCACAGACATC
AAGGGCTACAGGGACCCGGCCGCCGTCGAGAGCGGCAGGATGAAGAAGAGGAGGAGGAGGGCCCGCTCGGACAAG
CCGCCGGGGCTCCTCGACCAGGGGCCCGGGTCCGACGACCACTACTACGACGGCGACGGCGACGACGACGACGAC
GACGACGACGGCGACGGCGGCGGCAACGACGACGGCGAAAGCATCGAGGCCCTCGAGGACGTGACGGGCTGGAAG
CTGTTGCACGCCGATGTGTTCCGCAAGCCGCGCTTCGGCAACCTCCTGGCGCCGCTGGTCGGGTCCGGCATGCAG
CTGCTGTTCATGGCGGTCGGGCTGGTGCTGCTGAGCGCGCTCGGGGTGCTGAACCCCAGCTTCCGCGGCGGCTTC
ATCAGCGTCGGCGTCGGCCTCTTCGTCTTCGCCGGCCTCTTCTCCGGCTACTTCTCGGCGCGCGTCTTCCGCAGC
TTCGACGGCGTCGACTACCGGCGTAACGCCCTCGTCACCGCCCTCCTCTTCCCGGGCCTGACCTTCGGCCTCGTC
TTCATGCTCAACCTGTTCGTGTGGGCGCAGGCGTCGAGCACGGCGATACCGTTCGGCACGCTGCTGGCGATGCTG
CTGCTCTGGCTGTGCGTGCAGGTGCCGCTCGTGCTGGCCGGCTCCTACTACGGTTACGTCCGGGCCGGCGCGTGG
GAGCACCCGACCAAGACGGCGGCGGCGCCGCGGCCGATGCCGCGGCGGGCCTGGTACGCCGGCACGACGCAGTCG
GTGCTGCTGGCCGGCCTGATTCCCTTCGCCGTCATCTTCATTGAGCTGCTCTTCGTCTTCCAGTCGGTCTGGCAG
GACAAGAGCGGCTACTACTACGTCTTCGGCTTCCTGGCCGTCGTGCTCGTCATCCTGGCCGTGACGGTGGCCGAG
GTGACGGTCGTGACCGTCTACGTCCAGCTGTGCGCCGAGAACTACCACTGGTGGTGGCAGTCCTTCCTCGTCGGC
GGCGGCAGCGCCGTCTGGCTCATGGCCTACTGCCTCTGGTACTACGCCTTCAAGCTGCACATCAGCGGCTTCGTC
AGCAGCATGCTCTTCTTCACATACAGCTTCATGGCCTGCTGCGTCTACGGCCTGCTGACGGGCACGATCGGCTTC
CTGAGCGCCTACGCCTTTGTGCGGCGGATATACGGTGCAATCAAGGTCGACTGA
Transcript >Hirsu2|10128
ATGGTCGGCGCTTGGCGAGTCGGCCTGGGCGGCCTGCTTTCCCTCCTGCTGCACTCGTCCGCCCACGCCTTCTAC
ATACCCGGGTGGTCAATCAAGAGCCACAAGGAGGGCGTCCAGGTGCCTCTGATGGTCAACAAGGTCTACTCGGAC
AACACCCAGATACAGTACGCCTACTACGACCTGCCCTTCGTCTGCCCGCCCACCGGCCGCCACAAGGCCGCCGGC
GGCCTGCTGAGCGGCCAGAGCATCCCCCTCAACCTCGGCGAGGTCCTGCGCGGCGACCGCATCAAGGCCTCCGAC
ATGGAGCTCTTCATGCGCAGGGACAAGGCCTGCATCCTGCTCTGCACCAAGGAGCTCTCGCGCCGCGACGTGGCA
CGGACGAGGGGCCTGATCCGCGACGGCTACGTCGTTGAGTGGATCGTCGACAACCTCCCCGGCGCCACCAGCTTC
GTCACGACGGACAAGACGCGCAAGTACTACGCCGCCGGCTTCAAGCTGGGCTACGCCGAGCTCTCGCCCGCCACC
GGCAGGCCGCGCTACTTCCTGCACAACCACCATACCATTGTCATCCGCTACCGCAGGGCCTCGGGCCGCGCCGGC
CAGAGGGGCGAGTACATCGTCGTCGGCTTCGAGGTCTACCCCAAGAGCATCGGCCACGACAACAAGCGGGACGAC
GCCGGCTGCCCCGTCGACCTGCAGCACCTCGACGGCGCGCTCGAGCTCTCCATGGCCGCCAACCGAACCGACGAC
CGCGACGACGAGAGGAGCCGCCGGGCCGTCGCTGATGCTGCCGCCGCCGCCGCCGAGAGCGACGACGACGACGGC
GACGACGAGGTCGACGGCGCCTCCCTCACCATCCCCTACACCTACTCCGTCTACTTCCGCGAGGACGACAGCATC
GACTGGTCGCGCCGTTGGGACCTGTACTTCGTCAACCAAGAGGAGGGGTCGCGCATTCACTGGCTTGCCATTGTC
AACTCTCTCATCATCTGCGCCCTCCTCAGCAGCCTCGTCATGATCATCCTGGCCAAGACGATCCGCACAGACATC
AAGGGCTACAGGGACCCGGCCGCCGTCGAGAGCGGCAGGATGAAGAAGAGGAGGAGGAGGGCCCGCTCGGACAAG
CCGCCGGGGCTCCTCGACCAGGGGCCCGGGTCCGACGACCACTACTACGACGGCGACGGCGACGACGACGACGAC
GACGACGACGGCGACGGCGGCGGCAACGACGACGGCGAAAGCATCGAGGCCCTCGAGGACGTGACGGGCTGGAAG
CTGTTGCACGCCGATGTGTTCCGCAAGCCGCGCTTCGGCAACCTCCTGGCGCCGCTGGTCGGGTCCGGCATGCAG
CTGCTGTTCATGGCGGTCGGGCTGGTGCTGCTGAGCGCGCTCGGGGTGCTGAACCCCAGCTTCCGCGGCGGCTTC
ATCAGCGTCGGCGTCGGCCTCTTCGTCTTCGCCGGCCTCTTCTCCGGCTACTTCTCGGCGCGCGTCTTCCGCAGC
TTCGACGGCGTCGACTACCGGCGTAACGCCCTCGTCACCGCCCTCCTCTTCCCGGGCCTGACCTTCGGCCTCGTC
TTCATGCTCAACCTGTTCGTGTGGGCGCAGGCGTCGAGCACGGCGATACCGTTCGGCACGCTGCTGGCGATGCTG
CTGCTCTGGCTGTGCGTGCAGGTGCCGCTCGTGCTGGCCGGCTCCTACTACGGTTACGTCCGGGCCGGCGCGTGG
GAGCACCCGACCAAGACGGCGGCGGCGCCGCGGCCGATGCCGCGGCGGGCCTGGTACGCCGGCACGACGCAGTCG
GTGCTGCTGGCCGGCCTGATTCCCTTCGCCGTCATCTTCATTGAGCTGCTCTTCGTCTTCCAGTCGGTCTGGCAG
GACAAGAGCGGCTACTACTACGTCTTCGGCTTCCTGGCCGTCGTGCTCGTCATCCTGGCCGTGACGGTGGCCGAG
GTGACGGTCGTGACCGTCTACGTCCAGCTGTGCGCCGAGAACTACCACTGGTGGTGGCAGTCCTTCCTCGTCGGC
GGCGGCAGCGCCGTCTGGCTCATGGCCTACTGCCTCTGGTACTACGCCTTCAAGCTGCACATCAGCGGCTTCGTC
AGCAGCATGCTCTTCTTCACATACAGCTTCATGGCCTGCTGCGTCTACGGCCTGCTGACGGGCACGATCGGCTTC
CTGAGCGCCTACGCCTTTGTGCGGCGGATATACGGTGCAATCAAGGTCGACTGA
Gene >Hirsu2|10128
ATGGTCGGCGCTTGGCGAGTCGGCCTGGGCGGCCTGCTTTCCCTCCTGCTGCACTCGTCCGCCCACGCCTTCTAC
ATACCCGGTACGACCGAACTTTCCTCGCCGAACGCTCGCGTGCCTGGCTTTGTGTTGACGGCGTCGTCGCAGGGT
GGTCAATCAAGAGCCACAAGGAGGGCGTCCAGGTGCCTCTGATGGTCAACAAGGTCTACTCGGACAACACCCAGA
TACAGTACGCCTACTACGACCTGCCCTTCGTCTGCCCGCCCACCGGCCGCCACAAGGCCGCCGGCGGCCTGCTGA
GCGGCCAGAGCATCCCCCTCAACCTCGGCGAGGTCCTGCGCGGCGACCGCATCAAGGCCTCCGACATGGAGCTCT
TCATGCGCAGGGACAAGGCCTGCATCCTGCTCTGCACCAAGGAGCTCTCGCGCCGCGACGTGGCACGGACGAGGG
GCCTGATCCGCGACGGCTACGTCGTTGAGTGGATCGTCGACAACCTCCCCGGCGCCACCAGCTTCGTCACGACGG
ACAAGACGCGCAAGTACTACGCCGCCGGCTTCAAGCTGGGCTACGCCGAGCTCTCGCCCGCCACCGGCAGGCCGC
GCTACTTCCTGCACAACCACCATACCATTGTCATCCGCTACCGCAGGGCCTCGGGCCGCGCCGGCCAGAGGGGCG
AGTACATCGTCGTCGGCTTCGAGGTCTACCCCAAGAGCATCGGCCACGACAACAAGCGGGACGACGCCGGCTGCC
CCGTCGACCTGCAGCACCTCGACGGCGCGCTCGAGCTCTCCATGGCCGCCAACCGAACCGACGACCGCGACGACG
AGAGGAGCCGCCGGGCCGTCGCTGATGCTGCCGCCGCCGCCGCCGAGAGCGACGACGACGACGGCGACGACGAGG
TCGACGGCGCCTCCCTCACCATCCCCTACACCTACTCCGTCTACTTCCGCGAGGACGACAGCATCGACTGGTCGC
GCCGTTGGGACCTGTACTTCGTCAACCAAGAGGAGGGGTCGCGCATTCACTGGCTTGCCATTGTCAACTCTCTCA
TCATCTGCGCCCTCCTCAGCAGCCTCGTCATGATCATCCTGGCCAAGACGATCCGCACAGACATCAAGGGCTACA
GGGACCCGGCCGCCGTCGAGAGCGGCAGGATGAAGAAGAGGAGGAGGAGGGCCCGCTCGGACAAGCCGCCGGGGC
TCCTCGACCAGGGGCCCGGGTCCGACGACCACTACTACGACGGCGACGGCGACGACGACGACGACGACGACGACG
GCGACGGCGGCGGCAACGACGACGGCGAAAGCATCGAGGCCCTCGAGGACGTGACGGGCTGGAAGCTGTTGCACG
CCGATGTGTTCCGCAAGCCGCGCTTCGGCAACCTCCTGGCGCCGCTGGTCGGGTCCGGCATGCAGCTGCTGTTCA
TGGCGGTCGGGCTGGTGCTGCTGAGCGCGCTCGGGGTGCTGAACCCCAGCTTCCGCGGCGGCTTCATCAGCGTCG
GCGTCGGCCTCTTCGTCTTCGCCGGCCTCTTCTCCGGCTACTTCTCGGCGCGCGTCTTCCGCAGCTTCGACGGCG
TCGACTACCGGCGTAACGCCCTCGTCACCGCCCTCCTCTTCCCGGGCCTGACCTTCGGCCTCGTCTTCATGCTCA
ACCTGTTCGTGTGGGCGCAGGCGTCGAGCACGGCGATACCGTTCGGCACGCTGCTGGCGATGCTGCTGCTCTGGC
TGTGCGTGCAGGTGCCGCTCGTGCTGGCCGGCTCCTACTACGGTTACGTCCGGGCCGGCGCGTGGGAGCACCCGA
CCAAGACGGCGGCGGCGCCGCGGCCGATGCCGCGGCGGGCCTGGTACGCCGGCACGACGCAGTCGGTGCTGCTGG
CCGGCCTGATTCCCTTCGCCGTCATCTTCATTGAGCTGCTCTTCGTCTTCCAGTCGGTCTGGCAGGACAAGAGCG
GCTACTACTACGTCTTCGGCTTCCTGGCCGTCGTGCTCGTCATCCTGGCCGTGACGGTGGCCGAGGTGACGGTCG
TGACCGTCTACGTCCAGCTGTGCGCCGAGAACTACCACTGGTGGTGGCAGTCCTTCCTCGTCGGCGGCGGCAGCG
CCGTCTGGCTCATGGCCTACTGCCTCTGGTACTACGCCTTCAAGCTGCACATCAGCGGCTTCGTCAGCAGCATGC
TCTTCTTCACATACAGCTTCATGGCCTGCTGCGTCTACGGCCTGCTGACGGGCACGATCGGCTTCCTGAGCGCCT
ACGCCTTTGTGCGGCGGATATACGGGTAAGTCGCTTCATAGGCGGGCGGGGAGACGGATGCTGACTGGATCGTTT
CGTCAGTGCAATCAAGGTCGACTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail