Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10120
Gene name
LocationContig_791:6428..7484
Strand-
Gene length (bp)1056
Transcript length (bp)1056
Coding sequence length (bp)1056
Protein length (aa) 352

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02678 Pirin Pirin 7.5E-23 85 202

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P58116|YHHW_ECO57 Quercetin 2,3-dioxygenase OS=Escherichia coli O157:H7 GN=yhhW PE=3 SV=1 79 349 5.0E-37
sp|P46852|YHHW_ECOLI Quercetin 2,3-dioxygenase OS=Escherichia coli (strain K12) GN=yhhW PE=1 SV=1 79 265 8.0E-37
sp|P73623|Y1773_SYNY3 Putative quercetin 2,3-dioxygenase sll1773 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll1773 PE=3 SV=1 74 349 1.0E-34
sp|Q9I4C8|Y1210_PSEAE Putative quercetin 2,3-dioxygenase PA1210 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA1210 PE=3 SV=1 84 299 2.0E-33
sp|Q9XBR7|Y1337_ZYMMO Putative quercetin 2,3-dioxygenase ZMO1337 OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=ZMO1337 PE=3 SV=1 76 347 6.0E-33
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P58116|YHHW_ECO57 Quercetin 2,3-dioxygenase OS=Escherichia coli O157:H7 GN=yhhW PE=3 SV=1 79 349 5.0E-37
sp|P46852|YHHW_ECOLI Quercetin 2,3-dioxygenase OS=Escherichia coli (strain K12) GN=yhhW PE=1 SV=1 79 265 8.0E-37
sp|P73623|Y1773_SYNY3 Putative quercetin 2,3-dioxygenase sll1773 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll1773 PE=3 SV=1 74 349 1.0E-34
sp|Q9I4C8|Y1210_PSEAE Putative quercetin 2,3-dioxygenase PA1210 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA1210 PE=3 SV=1 84 299 2.0E-33
sp|Q9XBR7|Y1337_ZYMMO Putative quercetin 2,3-dioxygenase ZMO1337 OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=ZMO1337 PE=3 SV=1 76 347 6.0E-33
sp|Q9CKD7|Y1685_PASMU Putative quercetin 2,3-dioxygenase PM1685 OS=Pasteurella multocida (strain Pm70) GN=PM1685 PE=3 SV=1 83 342 3.0E-30
sp|P58113|Y1473_CAUCR Pirin-like protein CC_1473 OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=CC_1473 PE=3 SV=1 84 233 3.0E-29
sp|P65725|Y187_MYCBO Putative quercetin 2,3-dioxygenase Mb0187c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb0187c PE=3 SV=1 73 241 2.0E-28
sp|P9WI85|Y181_MYCTU Putative quercetin 2,3-dioxygenase Rv0181c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0181c PE=1 SV=1 73 241 2.0E-28
sp|P9WI84|Y181_MYCTO Putative quercetin 2,3-dioxygenase MT0190 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0190 PE=3 SV=1 73 241 2.0E-28
sp|P42624|YHAK_ECOLI Pirin-like protein YhaK OS=Escherichia coli (strain K12) GN=yhaK PE=1 SV=1 84 202 4.0E-11
sp|P58115|YHAK_ECO57 Pirin-like protein YhaK OS=Escherichia coli O157:H7 GN=yhaK PE=3 SV=1 84 202 6.0E-11
sp|Q9ZW82|PRNL2_ARATH Pirin-like protein At2g43120 OS=Arabidopsis thaliana GN=At2g43120 PE=2 SV=3 115 202 1.0E-10
sp|Q9LPS9|PRNL1_ARATH Pirin-like protein At1g50590 OS=Arabidopsis thaliana GN=At1g50590 PE=2 SV=1 107 202 5.0E-09
sp|Q9LX49|PRN1_ARATH Pirin-1 OS=Arabidopsis thaliana GN=PRN1 PE=1 SV=1 115 214 8.0E-09
sp|Q9SEE4|PIRL_SOLLC Pirin-like protein OS=Solanum lycopersicum PE=2 SV=1 105 202 3.0E-08
sp|Q9KKY1|Y3769_VIBCH Putative quercetin 2,3-dioxygenase VC_A0969 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=VC_A0969 PE=3 SV=1 99 212 1.0E-07
sp|P58112|Y481_CAUCR Pirin-like protein CC_0481 OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=CC_0481 PE=3 SV=1 107 328 1.0E-07
sp|Q9LX45|PRNL4_ARATH Putative pirin-like protein At3g59260 OS=Arabidopsis thaliana GN=At3g59260 PE=3 SV=1 116 202 2.0E-07
sp|Q9D711|PIR_MOUSE Pirin OS=Mus musculus GN=Pir PE=1 SV=1 105 224 3.0E-07
sp|O00625|PIR_HUMAN Pirin OS=Homo sapiens GN=PIR PE=1 SV=1 105 203 5.0E-07
sp|Q5M827|PIR_RAT Pirin OS=Rattus norvegicus GN=Pir PE=1 SV=1 105 224 5.0E-07
sp|Q9HZ00|Y3240_PSEAE Putative quercetin 2,3-dioxygenase PA3240 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA3240 PE=3 SV=1 125 212 1.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10120
MARLVLFGSLFFAFASILLVVRQEQPSVFSRPASFLINLFSSTANTTAIDHSDDQDLMRGSAVNMSKSTLRQASI
KPHRSGSRGHSDHGWLNTYHSFSFANWFNPNFTHFGSLRVLNEDRVKAKSGFPTHRHQDFEIFSYILSGELTHRD
STMTAKGAQGEQSDKFSRMHRGDVQFTTGGRGISHSEMNEHETDTVHFLQIWALPWKRGLTPQYHTKHFDEQDKK
NGFVTILSPLKAGEEASAQQEEEAEPAVDGSIPIHADFAMGAGIVAAQKTFEWTVGARATRETKRKVYVHLPMTK
GGKARIRLDGREDAELCEGDGAFVEGVSAGDRLAVESIGEAEAEVIVLDTA*
Coding >Hirsu2|10120
ATGGCCCGCCTCGTTCTCTTCGGCTCACTCTTCTTCGCTTTCGCTTCCATCCTCCTGGTCGTCCGTCAAGAACAG
CCATCCGTCTTCTCGAGACCAGCCAGCTTTCTCATCAACCTCTTCTCTAGCACGGCCAACACCACAGCCATCGAC
CACTCGGACGACCAAGACTTGATGCGCGGGTCGGCCGTCAACATGTCCAAGTCGACGCTTCGCCAAGCCAGCATC
AAGCCTCACCGGTCCGGCTCGCGGGGCCACTCGGACCACGGCTGGCTCAACACGTACCACAGCTTCTCCTTCGCC
AACTGGTTCAACCCCAACTTCACGCACTTCGGGTCGCTGAGGGTGCTGAACGAGGACCGGGTCAAGGCCAAGTCG
GGCTTCCCCACGCATCGGCATCAAGACTTTGAAATCTTCAGCTACATCCTATCGGGGGAGCTGACCCATCGAGAC
TCGACCATGACGGCCAAGGGGGCCCAAGGCGAGCAGTCGGACAAGTTCTCCCGCATGCATCGCGGCGATGTCCAG
TTCACGACGGGGGGCCGGGGCATCAGCCACTCGGAGATGAACGAGCACGAGACGGACACGGTCCACTTCTTGCAG
ATCTGGGCGCTGCCGTGGAAGAGAGGACTGACGCCGCAGTACCACACCAAGCACTTTGACGAGCAAGACAAGAAG
AACGGCTTCGTCACCATCCTAAGTCCGCTCAAGGCGGGCGAGGAGGCAAGCGCGCAGCAGGAGGAGGAGGCCGAG
CCGGCCGTCGACGGCTCGATCCCCATCCACGCTGACTTCGCCATGGGCGCCGGCATCGTGGCGGCGCAGAAGACG
TTTGAATGGACGGTGGGGGCCAGGGCCACGAGGGAAACCAAGCGCAAGGTCTACGTGCACCTGCCCATGACCAAG
GGCGGCAAGGCCAGGATCAGGCTGGACGGGCGCGAGGACGCAGAGCTCTGCGAGGGCGACGGCGCGTTCGTCGAA
GGAGTGAGTGCGGGAGACAGGCTGGCCGTGGAGAGCATCGGAGAGGCCGAGGCCGAGGTGATTGTGCTGGACACG
GCTTGA
Transcript >Hirsu2|10120
ATGGCCCGCCTCGTTCTCTTCGGCTCACTCTTCTTCGCTTTCGCTTCCATCCTCCTGGTCGTCCGTCAAGAACAG
CCATCCGTCTTCTCGAGACCAGCCAGCTTTCTCATCAACCTCTTCTCTAGCACGGCCAACACCACAGCCATCGAC
CACTCGGACGACCAAGACTTGATGCGCGGGTCGGCCGTCAACATGTCCAAGTCGACGCTTCGCCAAGCCAGCATC
AAGCCTCACCGGTCCGGCTCGCGGGGCCACTCGGACCACGGCTGGCTCAACACGTACCACAGCTTCTCCTTCGCC
AACTGGTTCAACCCCAACTTCACGCACTTCGGGTCGCTGAGGGTGCTGAACGAGGACCGGGTCAAGGCCAAGTCG
GGCTTCCCCACGCATCGGCATCAAGACTTTGAAATCTTCAGCTACATCCTATCGGGGGAGCTGACCCATCGAGAC
TCGACCATGACGGCCAAGGGGGCCCAAGGCGAGCAGTCGGACAAGTTCTCCCGCATGCATCGCGGCGATGTCCAG
TTCACGACGGGGGGCCGGGGCATCAGCCACTCGGAGATGAACGAGCACGAGACGGACACGGTCCACTTCTTGCAG
ATCTGGGCGCTGCCGTGGAAGAGAGGACTGACGCCGCAGTACCACACCAAGCACTTTGACGAGCAAGACAAGAAG
AACGGCTTCGTCACCATCCTAAGTCCGCTCAAGGCGGGCGAGGAGGCAAGCGCGCAGCAGGAGGAGGAGGCCGAG
CCGGCCGTCGACGGCTCGATCCCCATCCACGCTGACTTCGCCATGGGCGCCGGCATCGTGGCGGCGCAGAAGACG
TTTGAATGGACGGTGGGGGCCAGGGCCACGAGGGAAACCAAGCGCAAGGTCTACGTGCACCTGCCCATGACCAAG
GGCGGCAAGGCCAGGATCAGGCTGGACGGGCGCGAGGACGCAGAGCTCTGCGAGGGCGACGGCGCGTTCGTCGAA
GGAGTGAGTGCGGGAGACAGGCTGGCCGTGGAGAGCATCGGAGAGGCCGAGGCCGAGGTGATTGTGCTGGACACG
GCTTGA
Gene >Hirsu2|10120
ATGGCCCGCCTCGTTCTCTTCGGCTCACTCTTCTTCGCTTTCGCTTCCATCCTCCTGGTCGTCCGTCAAGAACAG
CCATCCGTCTTCTCGAGACCAGCCAGCTTTCTCATCAACCTCTTCTCTAGCACGGCCAACACCACAGCCATCGAC
CACTCGGACGACCAAGACTTGATGCGCGGGTCGGCCGTCAACATGTCCAAGTCGACGCTTCGCCAAGCCAGCATC
AAGCCTCACCGGTCCGGCTCGCGGGGCCACTCGGACCACGGCTGGCTCAACACGTACCACAGCTTCTCCTTCGCC
AACTGGTTCAACCCCAACTTCACGCACTTCGGGTCGCTGAGGGTGCTGAACGAGGACCGGGTCAAGGCCAAGTCG
GGCTTCCCCACGCATCGGCATCAAGACTTTGAAATCTTCAGCTACATCCTATCGGGGGAGCTGACCCATCGAGAC
TCGACCATGACGGCCAAGGGGGCCCAAGGCGAGCAGTCGGACAAGTTCTCCCGCATGCATCGCGGCGATGTCCAG
TTCACGACGGGGGGCCGGGGCATCAGCCACTCGGAGATGAACGAGCACGAGACGGACACGGTCCACTTCTTGCAG
ATCTGGGCGCTGCCGTGGAAGAGAGGACTGACGCCGCAGTACCACACCAAGCACTTTGACGAGCAAGACAAGAAG
AACGGCTTCGTCACCATCCTAAGTCCGCTCAAGGCGGGCGAGGAGGCAAGCGCGCAGCAGGAGGAGGAGGCCGAG
CCGGCCGTCGACGGCTCGATCCCCATCCACGCTGACTTCGCCATGGGCGCCGGCATCGTGGCGGCGCAGAAGACG
TTTGAATGGACGGTGGGGGCCAGGGCCACGAGGGAAACCAAGCGCAAGGTCTACGTGCACCTGCCCATGACCAAG
GGCGGCAAGGCCAGGATCAGGCTGGACGGGCGCGAGGACGCAGAGCTCTGCGAGGGCGACGGCGCGTTCGTCGAA
GGAGTGAGTGCGGGAGACAGGCTGGCCGTGGAGAGCATCGGAGAGGCCGAGGCCGAGGTGATTGTGCTGGACACG
GCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail