Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1012
Gene name
LocationContig_121:3642..4603
Strand-
Gene length (bp)961
Transcript length (bp)633
Coding sequence length (bp)633
Protein length (aa) 211

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01894 UPF0047 Uncharacterised protein family UPF0047 1.7E-36 84 204

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14155|YE72_SCHPO UPF0047 protein C4A8.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4A8.02c PE=3 SV=1 65 207 2.0E-46
sp|P0AF48|YJBQ_ECOLI UPF0047 protein YjbQ OS=Escherichia coli (strain K12) GN=yjbQ PE=3 SV=1 67 208 3.0E-43
sp|P0AF49|YJBQ_ECO57 UPF0047 protein YjbQ OS=Escherichia coli O157:H7 GN=yjbQ PE=3 SV=1 67 208 3.0E-43
sp|P0A2L1|YJBQ_SALTY UPF0047 protein YjbQ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=yjbQ PE=3 SV=1 67 208 2.0E-31
sp|P0A2L2|YJBQ_SALTI UPF0047 protein YjbQ OS=Salmonella typhi GN=yjbQ PE=3 SV=1 67 208 2.0E-31
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14155|YE72_SCHPO UPF0047 protein C4A8.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4A8.02c PE=3 SV=1 65 207 2.0E-46
sp|P0AF48|YJBQ_ECOLI UPF0047 protein YjbQ OS=Escherichia coli (strain K12) GN=yjbQ PE=3 SV=1 67 208 3.0E-43
sp|P0AF49|YJBQ_ECO57 UPF0047 protein YjbQ OS=Escherichia coli O157:H7 GN=yjbQ PE=3 SV=1 67 208 3.0E-43
sp|P0A2L1|YJBQ_SALTY UPF0047 protein YjbQ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=yjbQ PE=3 SV=1 67 208 2.0E-31
sp|P0A2L2|YJBQ_SALTI UPF0047 protein YjbQ OS=Salmonella typhi GN=yjbQ PE=3 SV=1 67 208 2.0E-31
sp|P74125|Y1880_SYNY3 UPF0047 protein sll1880 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll1880 PE=3 SV=1 63 209 7.0E-25
sp|Q58481|Y1081_METJA UPF0047 protein MJ1081 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1081 PE=3 SV=1 84 208 9.0E-16
sp|O28229|Y2050_ARCFU UPF0047 protein AF_2050 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_2050 PE=3 SV=1 71 205 2.0E-13
sp|O26865|Y771_METTH UPF0047 protein MTH_771 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=MTH_771 PE=3 SV=1 65 208 2.0E-13
sp|O05243|YUGU_BACSU UPF0047 protein YugU OS=Bacillus subtilis (strain 168) GN=yugU PE=3 SV=2 70 192 3.0E-12
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.5

Transmembrane Domains

Domain # Start End Length
1 13 35 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1012
MPLSSSAHGISTTATIALTLVLFVALFPDLFHLIWTLPLSLVRLPFSSRPPPSDRPDLQPQPAAMPWFQKQLTLP
SQSRGSYLITDQIVSSLPEIRNYKVGLLNLFVQHTSCALSLNENWDEDVREDMSNALDRIAPAHGPKGETLYLHS
AEGPDDMPAHIKSALIGASVTIPIKDGKLATGTWQGIWYLEFRASKHSRRIMATIQGETQ*
Coding >Hirsu2|1012
ATGCCTTTATCCTCGTCGGCTCACGGCATTTCCACGACAGCTACGATTGCGCTCACCCTCGTGCTCTTCGTCGCG
CTGTTCCCCGACCTCTTTCATCTCATCTGGACGCTGCCCTTGAGCCTCGTCCGCCTGCCCTTCTCGTCTCGGCCC
CCGCCGAGCGACCGTCCCGACCTACAGCCGCAGCCGGCAGCCATGCCTTGGTTCCAGAAGCAGCTGACGCTGCCG
TCCCAGTCGCGCGGCTCGTATCTGATCACCGACCAGATCGTGTCCTCCCTGCCGGAGATCAGGAACTACAAGGTC
GGTCTGCTGAACCTCTTTGTGCAGCATACGAGCTGCGCTCTGAGCCTGAACGAGAACTGGGACGAGGACGTCAGG
GAAGACATGAGCAACGCGCTGGACCGCATAGCCCCTGCCCATGGCCCCAAGGGCGAGACGCTGTACCTCCACAGC
GCCGAAGGACCCGACGACATGCCGGCCCATATCAAGTCGGCCCTCATCGGCGCCAGCGTGACGATTCCCATCAAG
GACGGAAAGCTGGCTACGGGCACCTGGCAAGGCATCTGGTATCTCGAGTTCCGGGCCAGCAAACACTCACGTCGA
ATCATGGCCACCATCCAGGGGGAGACGCAGTAG
Transcript >Hirsu2|1012
ATGCCTTTATCCTCGTCGGCTCACGGCATTTCCACGACAGCTACGATTGCGCTCACCCTCGTGCTCTTCGTCGCG
CTGTTCCCCGACCTCTTTCATCTCATCTGGACGCTGCCCTTGAGCCTCGTCCGCCTGCCCTTCTCGTCTCGGCCC
CCGCCGAGCGACCGTCCCGACCTACAGCCGCAGCCGGCAGCCATGCCTTGGTTCCAGAAGCAGCTGACGCTGCCG
TCCCAGTCGCGCGGCTCGTATCTGATCACCGACCAGATCGTGTCCTCCCTGCCGGAGATCAGGAACTACAAGGTC
GGTCTGCTGAACCTCTTTGTGCAGCATACGAGCTGCGCTCTGAGCCTGAACGAGAACTGGGACGAGGACGTCAGG
GAAGACATGAGCAACGCGCTGGACCGCATAGCCCCTGCCCATGGCCCCAAGGGCGAGACGCTGTACCTCCACAGC
GCCGAAGGACCCGACGACATGCCGGCCCATATCAAGTCGGCCCTCATCGGCGCCAGCGTGACGATTCCCATCAAG
GACGGAAAGCTGGCTACGGGCACCTGGCAAGGCATCTGGTATCTCGAGTTCCGGGCCAGCAAACACTCACGTCGA
ATCATGGCCACCATCCAGGGGGAGACGCAGTAG
Gene >Hirsu2|1012
ATGCCTTTATCCTCGTCGGCTCACGGCATTTCCACGACAGCTACGATTGCGCTCACCCTCGTGCTCTTCGTCGCG
CTGTTCCCCGACCTCTTTCATCTCATCTGGACGCTGCCCTTGAGCCTCGTCCGCCTGCCCTTCTCGTCTCGGCCC
CCGCCGAGCGACCGTCCCGACCTACAGCCGCAGCCGGCAGCCATGCCTTGGTTCCAGAAGCAGCTGACGCTGCCG
TCCCAGTCGCGCGGCTCGTATCTGATCACCGACCAGATCGTGTCCTCCCTGCCGGAGATCAGGAACTACAAGGTC
GGTCTGCTGAACCTCTTTGTGCAGCATACGAGCTGCGCTCTGAGCCTGAACGAGAACTGTACGTGACGCCACGAG
AAACGTCGGGAGCACAAAAAAAAAAAAGGGGGGGGGGGGGGGGCAAGAGCGGCCGTCGCCTCGCTCGGTTTTGTC
GAGTTGCTTGCTGAATCGCGCTGCGGGCAGGGGACGAGGACGTCAGGGAAGACATGAGCAACGCGCTGGACCGCA
TAGCCCCTGCCCATGGCCCCAAGGGCGAGACGCTGTACCTCCACAGGTGAGCCGGTGGACACGAGCAAGCACAAG
AGGCCGTGAGCCGGAGTAACCAGGCCTATTTCTCCCGCAACAGCGCCGAAGGACCCGACGACATGCCGGTGAGTG
CCGTTGGGCAGACCTGGCACGCGTTGACGAGGCTGAGCTGAAAACGGCCCGTACAGGCCCATATCAAGTCGGCCC
TCATCGGCGCCAGCGTGACGATTCCCATCAAGGACGGAAAGCTGGTGCGTCAAGCAAGACCAAGGCCCAACCGCA
CACGGCGCTGACTGGGGTTTGTCCCCCTTCTCCCCCATAGGCTACGGGCACCTGGCAAGGCATCTGGTATCTCGA
GTTCCGGGCCAGCAAACACTCACGTCGAATCATGGCCACCATCCAGGGGGAGACGCAGTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail