Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10116
Gene name
LocationContig_790:3866..5974
Strand-
Gene length (bp)2108
Transcript length (bp)1938
Coding sequence length (bp)1938
Protein length (aa) 646

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04082 Fungal_trans Fungal specific transcription factor domain 3.0E-16 155 331

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P07272|PPR1_YEAST Pyrimidine pathway regulatory protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPR1 PE=1 SV=1 193 453 7.0E-11
sp|Q9P6I9|YHDD_SCHPO Uncharacterized transcriptional regulatory protein C1683.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.13c PE=1 SV=1 1 315 2.0E-10
sp|P04386|GAL4_YEAST Regulatory protein GAL4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAL4 PE=1 SV=2 144 390 4.0E-09
sp|P38699|STB5_YEAST Protein STB5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STB5 PE=1 SV=1 153 329 5.0E-09
sp|P87000|ACU15_NEUCR Transcriptional activator protein acu-15 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=acu-15 PE=1 SV=2 2 493 2.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P07272|PPR1_YEAST Pyrimidine pathway regulatory protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPR1 PE=1 SV=1 193 453 7.0E-11
sp|Q9P6I9|YHDD_SCHPO Uncharacterized transcriptional regulatory protein C1683.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.13c PE=1 SV=1 1 315 2.0E-10
sp|P04386|GAL4_YEAST Regulatory protein GAL4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAL4 PE=1 SV=2 144 390 4.0E-09
sp|P38699|STB5_YEAST Protein STB5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STB5 PE=1 SV=1 153 329 5.0E-09
sp|P87000|ACU15_NEUCR Transcriptional activator protein acu-15 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=acu-15 PE=1 SV=2 2 493 2.0E-06
sp|O14130|YF54_SCHPO Uncharacterized transcriptional regulatory protein C3C7.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3C7.04 PE=3 SV=1 144 400 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006351 transcription, DNA-templated Yes
GO:0003677 DNA binding Yes
GO:0008270 zinc ion binding Yes
GO:0097159 organic cyclic compound binding No
GO:1901360 organic cyclic compound metabolic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0009987 cellular process No
GO:1901363 heterocyclic compound binding No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0032774 RNA biosynthetic process No
GO:0003676 nucleic acid binding No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0009059 macromolecule biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0005488 binding No
GO:0044249 cellular biosynthetic process No
GO:0009058 biosynthetic process No
GO:0008150 biological_process No
GO:0046483 heterocycle metabolic process No
GO:0097659 nucleic acid-templated transcription No
GO:0043170 macromolecule metabolic process No
GO:0044237 cellular metabolic process No
GO:0046914 transition metal ion binding No
GO:1901576 organic substance biosynthetic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0003674 molecular_function No
GO:0019438 aromatic compound biosynthetic process No
GO:0018130 heterocycle biosynthetic process No
GO:0008152 metabolic process No
GO:0046872 metal ion binding No
GO:0043167 ion binding No
GO:0044238 primary metabolic process No
GO:0043169 cation binding No
GO:0016070 RNA metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0090304 nucleic acid metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Fungal Specific TF

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10116
LPACTACEKAGRENECSAANDQFARGKERSYVAALELRIEKLERRLQYAKSRKASVALHELDASAMTQVDRRDSL
ASIRAAIHRKAARNRENHDVNSIVSDFGLLSVDATSRDFEPSASNVTFARLVLAATTNDMIPAPAPPGLPPRPAA
LAIVQYFMTNIYSLFPCFSETTLLTVLDDVYRQDERVAKDSGYWLLYMVLAIGSTAQSQSINDERYRQGVSFVSK
ALPYADRALAPGYVTQIQSLLLLTLYSMLDPSHFDSWHLIGFTARAVVDLGFHQDPPLSSGSDKSALDMRRKIFY
CVYALDRAISMAHARTFSFTDDAVNVAFPSKSGAPGKQLMPGAMAGPQCADPALLLFQLRRAQSFWYQELYQSDP
TPLANPSSFLWQMCLDMREWGESLPVTLPAGTRRMFEQELWYSYVYCIAPSARAPQITDHSRILIFEYSLAYLDS
MHNTARSGLNSAFYTYHDALKVYFMANQFLAVLRDAEDLVVSGAHVPLPPSLPGCAPPPSIPRRQLRPGAAAEDN
LERILWCLGRIPETLGLYGTRWEDAIMLKQSFEQISVETVERLRERQRLRNVVPLVQHQSPYQNGITAVPPPTLI
HAQGPPPPPPPPQQQQQQQQQQQQPVDMRWATVDPAHMMQVAGHH*
Coding >Hirsu2|10116
CTGCCTGCCTGCACCGCCTGCGAAAAGGCCGGCCGTGAGAATGAGTGCTCCGCCGCCAACGACCAATTTGCCCGC
GGCAAGGAGCGAAGCTATGTCGCCGCCCTCGAGTTGCGCATCGAGAAGCTCGAAAGACGCCTGCAATATGCCAAG
TCGAGAAAGGCTTCCGTCGCTCTACACGAACTCGATGCTTCGGCCATGACCCAGGTCGACCGCAGGGATTCGCTC
GCCTCGATCCGAGCGGCCATTCATCGCAAGGCCGCCAGAAATCGCGAAAACCACGATGTCAACTCGATAGTCTCC
GACTTTGGCTTGTTGTCCGTCGATGCCACGTCCCGCGACTTCGAGCCATCTGCCAGCAATGTGACGTTTGCCAGG
CTCGTCCTCGCCGCCACGACAAACGACATGATCCCGGCACCCGCTCCGCCGGGCTTGCCGCCCCGGCCGGCTGCC
CTTGCCATCGTGCAATACTTCATGACCAATATCTACTCGCTGTTTCCATGCTTCTCCGAGACAACTCTCTTGACC
GTACTGGACGACGTCTATCGGCAGGATGAACGTGTGGCAAAGGACTCGGGCTACTGGCTTCTGTACATGGTTCTC
GCCATCGGGTCGACCGCCCAAAGTCAGAGCATCAACGACGAGCGCTACCGGCAAGGTGTAAGCTTCGTCTCCAAG
GCCTTGCCCTACGCAGACAGGGCCCTCGCCCCCGGATACGTCACTCAGATTCAATCCCTCCTGCTCTTGACCCTC
TACTCCATGCTTGATCCGTCCCACTTTGATAGTTGGCACCTCATCGGCTTCACGGCCCGGGCCGTGGTGGACTTG
GGCTTCCATCAGGACCCGCCGCTGTCGTCGGGTTCGGACAAGTCTGCCCTGGACATGCGGCGCAAGATCTTCTAC
TGCGTGTACGCTCTTGATCGCGCCATCAGCATGGCTCATGCGCGCACCTTTTCCTTCACCGACGACGCGGTCAAC
GTGGCGTTTCCGAGCAAGTCCGGCGCGCCCGGGAAGCAGCTCATGCCCGGAGCCATGGCGGGCCCGCAATGCGCC
GATCCGGCCCTGCTGCTCTTCCAGCTCCGCCGAGCCCAGTCCTTTTGGTACCAGGAGCTCTACCAGTCGGATCCC
ACCCCCCTGGCGAACCCGTCGTCATTCCTCTGGCAAATGTGCCTAGATATGCGCGAATGGGGAGAATCTCTCCCC
GTCACCTTACCAGCGGGCACACGGCGTATGTTCGAGCAAGAACTGTGGTACAGTTACGTGTACTGCATCGCTCCG
TCGGCCAGAGCCCCTCAGATCACCGACCACAGCCGCATCTTGATCTTCGAGTATTCGCTGGCCTACCTCGACAGT
ATGCACAACACGGCGCGCAGCGGGCTAAACAGCGCCTTCTATACTTACCACGACGCTTTGAAGGTGTATTTCATG
GCCAACCAATTTCTGGCGGTGCTTCGGGATGCCGAAGATTTGGTCGTTTCCGGCGCCCACGTACCTCTGCCACCC
TCCCTGCCGGGCTGCGCCCCGCCTCCGTCGATTCCACGACGTCAACTGCGCCCCGGCGCCGCGGCCGAAGACAAC
CTGGAGAGGATCCTGTGGTGCCTGGGAAGGATTCCCGAGACATTGGGTCTGTACGGCACTCGATGGGAGGATGCC
ATCATGCTCAAGCAGAGCTTCGAACAGATATCCGTCGAGACGGTTGAGCGGCTACGAGAACGGCAGCGGCTACGC
AATGTTGTTCCCTTGGTCCAGCATCAAAGTCCTTACCAGAACGGCATCACTGCGGTCCCTCCACCCACTCTCATA
CACGCTCAAGGCCCGCCGCCCCCGCCCCCGCCGCCACAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAACCG
GTCGATATGAGATGGGCGACGGTAGACCCTGCGCACATGATGCAGGTGGCGGGTCATCATTGA
Transcript >Hirsu2|10116
CTGCCTGCCTGCACCGCCTGCGAAAAGGCCGGCCGTGAGAATGAGTGCTCCGCCGCCAACGACCAATTTGCCCGC
GGCAAGGAGCGAAGCTATGTCGCCGCCCTCGAGTTGCGCATCGAGAAGCTCGAAAGACGCCTGCAATATGCCAAG
TCGAGAAAGGCTTCCGTCGCTCTACACGAACTCGATGCTTCGGCCATGACCCAGGTCGACCGCAGGGATTCGCTC
GCCTCGATCCGAGCGGCCATTCATCGCAAGGCCGCCAGAAATCGCGAAAACCACGATGTCAACTCGATAGTCTCC
GACTTTGGCTTGTTGTCCGTCGATGCCACGTCCCGCGACTTCGAGCCATCTGCCAGCAATGTGACGTTTGCCAGG
CTCGTCCTCGCCGCCACGACAAACGACATGATCCCGGCACCCGCTCCGCCGGGCTTGCCGCCCCGGCCGGCTGCC
CTTGCCATCGTGCAATACTTCATGACCAATATCTACTCGCTGTTTCCATGCTTCTCCGAGACAACTCTCTTGACC
GTACTGGACGACGTCTATCGGCAGGATGAACGTGTGGCAAAGGACTCGGGCTACTGGCTTCTGTACATGGTTCTC
GCCATCGGGTCGACCGCCCAAAGTCAGAGCATCAACGACGAGCGCTACCGGCAAGGTGTAAGCTTCGTCTCCAAG
GCCTTGCCCTACGCAGACAGGGCCCTCGCCCCCGGATACGTCACTCAGATTCAATCCCTCCTGCTCTTGACCCTC
TACTCCATGCTTGATCCGTCCCACTTTGATAGTTGGCACCTCATCGGCTTCACGGCCCGGGCCGTGGTGGACTTG
GGCTTCCATCAGGACCCGCCGCTGTCGTCGGGTTCGGACAAGTCTGCCCTGGACATGCGGCGCAAGATCTTCTAC
TGCGTGTACGCTCTTGATCGCGCCATCAGCATGGCTCATGCGCGCACCTTTTCCTTCACCGACGACGCGGTCAAC
GTGGCGTTTCCGAGCAAGTCCGGCGCGCCCGGGAAGCAGCTCATGCCCGGAGCCATGGCGGGCCCGCAATGCGCC
GATCCGGCCCTGCTGCTCTTCCAGCTCCGCCGAGCCCAGTCCTTTTGGTACCAGGAGCTCTACCAGTCGGATCCC
ACCCCCCTGGCGAACCCGTCGTCATTCCTCTGGCAAATGTGCCTAGATATGCGCGAATGGGGAGAATCTCTCCCC
GTCACCTTACCAGCGGGCACACGGCGTATGTTCGAGCAAGAACTGTGGTACAGTTACGTGTACTGCATCGCTCCG
TCGGCCAGAGCCCCTCAGATCACCGACCACAGCCGCATCTTGATCTTCGAGTATTCGCTGGCCTACCTCGACAGT
ATGCACAACACGGCGCGCAGCGGGCTAAACAGCGCCTTCTATACTTACCACGACGCTTTGAAGGTGTATTTCATG
GCCAACCAATTTCTGGCGGTGCTTCGGGATGCCGAAGATTTGGTCGTTTCCGGCGCCCACGTACCTCTGCCACCC
TCCCTGCCGGGCTGCGCCCCGCCTCCGTCGATTCCACGACGTCAACTGCGCCCCGGCGCCGCGGCCGAAGACAAC
CTGGAGAGGATCCTGTGGTGCCTGGGAAGGATTCCCGAGACATTGGGTCTGTACGGCACTCGATGGGAGGATGCC
ATCATGCTCAAGCAGAGCTTCGAACAGATATCCGTCGAGACGGTTGAGCGGCTACGAGAACGGCAGCGGCTACGC
AATGTTGTTCCCTTGGTCCAGCATCAAAGTCCTTACCAGAACGGCATCACTGCGGTCCCTCCACCCACTCTCATA
CACGCTCAAGGCCCGCCGCCCCCGCCCCCGCCGCCACAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAACCG
GTCGATATGAGATGGGCGACGGTAGACCCTGCGCACATGATGCAGGTGGCGGGTCATCATTGA
Gene >Hirsu2|10116
CTGCCTGCCTGCACCGCCTGCGAAAAGGCCGGCCGTGAGAATGAGTGCTCCGCCGCCAACGACCAATTTGCCCGC
GGCAAGGAGCGAAGGTGAGTCCCTCTCCCCCCCAGGCGTCAACGGCTTGTGCCTGATGCCCTGTGCCCTAGCTAT
GTCGCCGCCCTCGAGTTGCGCATCGAGAAGCTCGAAAGACGCCTGCAATATGCCAAGTCGAGAAAGGCTTCCGTC
GCTCTACACGAACTCGATGCTTCGGCCATGACCCAGGTCGACCGCAGGGATTCGCTCGCCTCGATCCGAGCGGCC
ATTCATCGCAAGGCCGCCAGAAATCGCGAAAACCACGATGTCAACTCGATAGTCTCCGACTTTGGCTTGTTGTAA
GTGCCGCGTGCCGAATCTGCTTCAGCCCCCCTTGCTGAGCCCGGACTAGGTCCGTCGATGCCACGTCCCGCGACT
TCGAGCCATCTGCCAGCAATGTGACGTTTGCCAGGCTCGTCCTCGCCGCCACGACAAACGACATGATCCCGGCAC
CCGCTCCGCCGGGCTTGCCGCCCCGGCCGGCTGCCCTTGCCATCGTGCAATACTTCATGACCAATATCTACTCGC
TGTTTCCATGCTTCTCCGAGACAACTCTCTTGACCGTACTGGACGACGTCTATCGGCAGGATGAACGTGTGGCAA
AGGACTCGGGCTACTGGCTTCTGTACATGGTTCTCGCCATCGGGTCGACCGCCCAAAGTCAGAGCATCAACGACG
AGCGCTACCGGCAAGGTGTAAGCTTCGTCTCCAAGGCCTTGCCCTACGCAGACAGGGCCCTCGCCCCCGGATACG
TCACTCAGATTCAATCCCTCCTGCTCTTGACCCTCTACTCCATGCTTGATCCGTCCCACTTTGATAGTTGGCACC
TCATCGGCTTCACGGCCCGGGCCGTGGTGGACTTGGGCTTCCATCAGGACCCGCCGCTGTCGTCGGGTTCGGACA
AGTCTGCCCTGGACATGCGGCGCAAGATCTTCTACTGCGTGTACGCTCTTGATCGGTAGGTCACAGCCACGTCCC
AACCGGGCGCCGCTTCGAGGCTGACGTCGTCTCAACGCAGCGCCATCAGCATGGCTCATGCGCGCACCTTTTCCT
TCACCGACGACGCGGTCAACGTGGCGTTTCCGAGCAAGTCCGGCGCGCCCGGGAAGCAGCTCATGCCCGGAGCCA
TGGCGGGCCCGCAATGCGCCGATCCGGCCCTGCTGCTCTTCCAGCTCCGCCGAGCCCAGTCCTTTTGGTACCAGG
AGCTCTACCAGTCGGATCCCACCCCCCTGGCGAACCCGTCGTCATTCCTCTGGCAAATGTGCCTAGATATGCGCG
AATGGGGAGAATCTCTCCCCGTCACCTTACCAGCGGGCACACGGCGTATGTTCGAGCAAGAACTGTGGTACAGTT
ACGTGTACTGCATCGCTCCGTCGGCCAGAGCCCCTCAGATCACCGACCACAGCCGCATCTTGATCTTCGAGTATT
CGCTGGCCTACCTCGACAGTATGCACAACACGGCGCGCAGCGGGCTAAACAGCGCCTTCTATACTTACCACGACG
CTTTGAAGGTGTATTTCATGGCCAACCAATTTCTGGCGGTGCTTCGGGATGCCGAAGATTTGGTCGTTTCCGGCG
CCCACGTACCTCTGCCACCCTCCCTGCCGGGCTGCGCCCCGCCTCCGTCGATTCCACGACGTCAACTGCGCCCCG
GCGCCGCGGCCGAAGACAACCTGGAGAGGATCCTGTGGTGCCTGGGAAGGATTCCCGAGACATTGGGTCTGTACG
GCACTCGATGGGAGGATGCCATCATGCTCAAGCAGAGCTTCGAACAGATATCCGTCGAGACGGTTGAGCGGCTAC
GAGAACGGCAGCGGCTACGCAATGTTGTTCCCTTGGTCCAGCATCAAAGTCCTTACCAGAACGGCATCACTGCGG
TCCCTCCACCCACTCTCATACACGCTCAAGGCCCGCCGCCCCCGCCCCCGCCGCCACAGCAGCAGCAGCAGCAGC
AGCAGCAGCAGCAGCAACCGGTCGATATGAGATGGGCGACGGTAGACCCTGCGCACATGATGCAGGTGGCGGGTC
ATCATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail