Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10111
Gene name
LocationContig_79:26883..28900
Strand-
Gene length (bp)2017
Transcript length (bp)1917
Coding sequence length (bp)1917
Protein length (aa) 639

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01794 Ferric_reduct Ferric reductase like transmembrane component 4.1E-16 141 258
PF08022 FAD_binding_8 FAD-binding domain 2.4E-11 333 421
PF08030 NAD_binding_6 Ferric reductase NAD binding domain 1.2E-05 427 611

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q12333|FRE7_YEAST Ferric/cupric reductase transmembrane component 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE7 PE=1 SV=2 162 638 1.0E-13
sp|P36033|FRE2_YEAST Ferric/cupric reductase transmembrane component 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE2 PE=1 SV=1 139 636 1.0E-12
sp|P53746|FRE4_YEAST Ferric reductase transmembrane component 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE4 PE=2 SV=1 136 613 5.0E-12
sp|Q12473|FRE6_YEAST Ferric reductase transmembrane component 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE6 PE=1 SV=1 139 613 2.0E-07

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0055114 oxidation-reduction process Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.5

Transmembrane Domains

Domain # Start End Length
1 20 42 22
2 104 126 22
3 146 168 22
4 175 197 22
5 217 236 19
6 243 265 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10111
MDMEHMHHSAGIGSDLNHAFARAYWYMAAGVVGLVVGVRAVNHCVALQRLKACADASVAHTACARPRGRLGRAWA
TATALVREASHPQLRIKARCLAWASPPPLGRALVLLAYWAVVAVLMSRDAVVADVFYHERIGYRNAWVTLAQLPM
AQLLAVKCASPLAWLLGCGPERLSWLHRWVARTMLVVATVHGFSFWTEWERADFVAFELSVMPMVKYGLGAWAVL
LWSVVAGFLPVRRLAYELWLLQHLASVVAMLWLLYRHIPASARYLLWMTVGLLAYDRLARWLLLLRRNLHWSLLF
AFFPSSSSSSSLSTNRRRRLGRFGHEMSIRAVGDVLTVLTIRDVSFKWCPGQHVYLWVPRLGPLEAHPYTIGCAP
AHGPNNDGFRLVVRTHAGFSKRIHDYASRHPERTLMAFLSGPYGVPPRLDTYETLVLIGASTGASFVVPMLESIA
MAPGRTCVRSVDVALIARTTAEIGAYLRQTKDASRRARDRGMRVRLHVAITAEAGVPLVRMRRPRDAGRAEKVET
DDDDAIEPFPQPEETTGFRQRSGSRSPSPTGRSRGSSLGDLDFVHEYVARPDIEALVRQPVEQAWGETAVVVCGG
AELVARTRNCVSRLSDERAVHKGTGAQGIYLYVEEYAF*
Coding >Hirsu2|10111
ATGGACATGGAACACATGCATCACAGCGCCGGCATCGGCTCCGACCTCAATCATGCCTTTGCGCGCGCCTACTGG
TACATGGCGGCCGGTGTCGTCGGCCTTGTCGTCGGCGTCCGGGCCGTCAACCACTGCGTCGCTCTTCAAAGACTC
AAGGCCTGCGCCGATGCGTCCGTCGCCCACACGGCCTGCGCCCGGCCTCGGGGCCGGCTCGGCCGCGCCTGGGCC
ACGGCCACGGCGCTGGTCCGCGAGGCCAGCCACCCGCAGCTTCGCATCAAGGCCCGATGCCTGGCCTGGGCGTCG
CCGCCGCCGCTGGGCCGCGCCCTGGTCCTGCTCGCCTACTGGGCCGTCGTCGCCGTCCTGATGAGCCGCGACGCC
GTCGTCGCCGACGTCTTCTACCATGAGCGCATCGGCTACCGCAACGCCTGGGTCACGCTGGCACAGCTGCCCATG
GCCCAGCTGCTGGCCGTCAAGTGCGCCAGCCCGCTCGCCTGGCTTCTCGGCTGCGGCCCCGAGCGGCTCAGCTGG
CTCCATCGCTGGGTGGCCCGCACGATGCTTGTCGTCGCCACCGTCCACGGCTTCAGCTTCTGGACCGAGTGGGAG
CGCGCCGACTTTGTCGCCTTCGAGCTGTCCGTCATGCCCATGGTCAAGTACGGCCTTGGTGCCTGGGCCGTGCTG
CTGTGGTCCGTCGTCGCCGGCTTCCTGCCCGTCCGCCGCCTCGCCTACGAGCTCTGGCTGCTGCAGCATCTGGCC
TCGGTCGTCGCCATGCTGTGGCTGCTGTACCGGCACATCCCGGCCTCGGCCCGCTACCTGCTCTGGATGACCGTC
GGTCTTCTCGCCTATGATCGCCTCGCCCGCTGGCTGCTGCTGCTGCGGCGCAACTTGCACTGGTCCTTGCTCTTC
GCCTTCTTTCCCTCTTCTTCCTCTTCCTCCTCCTTGTCGACGAACCGTCGCCGGCGCCTCGGCCGCTTCGGTCAC
GAAATGTCGATTCGAGCCGTCGGCGATGTCCTCACTGTCCTGACCATTCGAGACGTTAGTTTCAAGTGGTGCCCC
GGCCAGCACGTCTACCTCTGGGTTCCGCGCCTCGGGCCGCTCGAAGCTCATCCGTACACGATAGGCTGCGCTCCG
GCTCATGGGCCGAACAACGACGGCTTTCGGCTCGTTGTCCGGACCCATGCCGGGTTCTCAAAGCGTATCCACGAC
TACGCGTCCCGACACCCAGAGCGGACCCTCATGGCCTTCCTCTCGGGGCCGTACGGAGTTCCGCCCCGGCTGGAC
ACGTACGAGACGCTCGTCCTCATCGGCGCCTCCACGGGCGCGAGCTTCGTCGTCCCCATGCTGGAGAGCATCGCG
ATGGCCCCGGGCAGGACGTGCGTACGCAGCGTCGACGTGGCCCTCATCGCCCGGACGACCGCCGAGATCGGCGCC
TACCTACGACAGACCAAGGACGCCAGCAGACGGGCACGCGACCGGGGCATGCGCGTGCGACTCCACGTCGCCATC
ACGGCCGAGGCCGGCGTGCCTCTGGTTCGGATGCGCCGGCCGAGAGACGCCGGCCGTGCGGAAAAGGTGGAAACC
GACGACGACGACGCCATCGAACCCTTCCCCCAGCCCGAAGAGACGACTGGCTTCCGGCAAAGAAGTGGCAGCCGG
AGCCCATCGCCGACAGGCCGTTCTCGGGGGAGCAGCCTGGGCGATCTCGACTTCGTGCACGAATACGTGGCAAGG
CCCGACATCGAGGCTCTGGTCCGGCAGCCCGTAGAGCAGGCATGGGGCGAAACGGCCGTCGTCGTCTGCGGTGGC
GCGGAGCTCGTGGCGAGGACACGCAACTGCGTCAGCCGTTTGAGCGACGAGAGGGCTGTCCACAAGGGCACTGGC
GCCCAGGGCATCTACCTCTATGTCGAGGAGTATGCCTTTTGA
Transcript >Hirsu2|10111
ATGGACATGGAACACATGCATCACAGCGCCGGCATCGGCTCCGACCTCAATCATGCCTTTGCGCGCGCCTACTGG
TACATGGCGGCCGGTGTCGTCGGCCTTGTCGTCGGCGTCCGGGCCGTCAACCACTGCGTCGCTCTTCAAAGACTC
AAGGCCTGCGCCGATGCGTCCGTCGCCCACACGGCCTGCGCCCGGCCTCGGGGCCGGCTCGGCCGCGCCTGGGCC
ACGGCCACGGCGCTGGTCCGCGAGGCCAGCCACCCGCAGCTTCGCATCAAGGCCCGATGCCTGGCCTGGGCGTCG
CCGCCGCCGCTGGGCCGCGCCCTGGTCCTGCTCGCCTACTGGGCCGTCGTCGCCGTCCTGATGAGCCGCGACGCC
GTCGTCGCCGACGTCTTCTACCATGAGCGCATCGGCTACCGCAACGCCTGGGTCACGCTGGCACAGCTGCCCATG
GCCCAGCTGCTGGCCGTCAAGTGCGCCAGCCCGCTCGCCTGGCTTCTCGGCTGCGGCCCCGAGCGGCTCAGCTGG
CTCCATCGCTGGGTGGCCCGCACGATGCTTGTCGTCGCCACCGTCCACGGCTTCAGCTTCTGGACCGAGTGGGAG
CGCGCCGACTTTGTCGCCTTCGAGCTGTCCGTCATGCCCATGGTCAAGTACGGCCTTGGTGCCTGGGCCGTGCTG
CTGTGGTCCGTCGTCGCCGGCTTCCTGCCCGTCCGCCGCCTCGCCTACGAGCTCTGGCTGCTGCAGCATCTGGCC
TCGGTCGTCGCCATGCTGTGGCTGCTGTACCGGCACATCCCGGCCTCGGCCCGCTACCTGCTCTGGATGACCGTC
GGTCTTCTCGCCTATGATCGCCTCGCCCGCTGGCTGCTGCTGCTGCGGCGCAACTTGCACTGGTCCTTGCTCTTC
GCCTTCTTTCCCTCTTCTTCCTCTTCCTCCTCCTTGTCGACGAACCGTCGCCGGCGCCTCGGCCGCTTCGGTCAC
GAAATGTCGATTCGAGCCGTCGGCGATGTCCTCACTGTCCTGACCATTCGAGACGTTAGTTTCAAGTGGTGCCCC
GGCCAGCACGTCTACCTCTGGGTTCCGCGCCTCGGGCCGCTCGAAGCTCATCCGTACACGATAGGCTGCGCTCCG
GCTCATGGGCCGAACAACGACGGCTTTCGGCTCGTTGTCCGGACCCATGCCGGGTTCTCAAAGCGTATCCACGAC
TACGCGTCCCGACACCCAGAGCGGACCCTCATGGCCTTCCTCTCGGGGCCGTACGGAGTTCCGCCCCGGCTGGAC
ACGTACGAGACGCTCGTCCTCATCGGCGCCTCCACGGGCGCGAGCTTCGTCGTCCCCATGCTGGAGAGCATCGCG
ATGGCCCCGGGCAGGACGTGCGTACGCAGCGTCGACGTGGCCCTCATCGCCCGGACGACCGCCGAGATCGGCGCC
TACCTACGACAGACCAAGGACGCCAGCAGACGGGCACGCGACCGGGGCATGCGCGTGCGACTCCACGTCGCCATC
ACGGCCGAGGCCGGCGTGCCTCTGGTTCGGATGCGCCGGCCGAGAGACGCCGGCCGTGCGGAAAAGGTGGAAACC
GACGACGACGACGCCATCGAACCCTTCCCCCAGCCCGAAGAGACGACTGGCTTCCGGCAAAGAAGTGGCAGCCGG
AGCCCATCGCCGACAGGCCGTTCTCGGGGGAGCAGCCTGGGCGATCTCGACTTCGTGCACGAATACGTGGCAAGG
CCCGACATCGAGGCTCTGGTCCGGCAGCCCGTAGAGCAGGCATGGGGCGAAACGGCCGTCGTCGTCTGCGGTGGC
GCGGAGCTCGTGGCGAGGACACGCAACTGCGTCAGCCGTTTGAGCGACGAGAGGGCTGTCCACAAGGGCACTGGC
GCCCAGGGCATCTACCTCTATGTCGAGGAGTATGCCTTTTGA
Gene >Hirsu2|10111
ATGGACATGGAACACATGCATCACAGCGCCGGCATCGGCTCCGACCTCAATCATGCCTTTGCGCGCGCCTACTGG
TACATGGCGGCCGGTGTCGTCGGCCTTGTCGTCGGCGTCCGGGCCGTCAACCACTGCGTCGCTCTTCAAAGGTGC
GTGAAGCCGTGAACGAGATTCCTGTCCGGCGACCGGCTCTGGACACACACGGGGAGGAGAGAGGGAGCCTCTGGC
TGACGCCCGACACGCACATAGACTCAAGGCCTGCGCCGATGCGTCCGTCGCCCACACGGCCTGCGCCCGGCCTCG
GGGCCGGCTCGGCCGCGCCTGGGCCACGGCCACGGCGCTGGTCCGCGAGGCCAGCCACCCGCAGCTTCGCATCAA
GGCCCGATGCCTGGCCTGGGCGTCGCCGCCGCCGCTGGGCCGCGCCCTGGTCCTGCTCGCCTACTGGGCCGTCGT
CGCCGTCCTGATGAGCCGCGACGCCGTCGTCGCCGACGTCTTCTACCATGAGCGCATCGGCTACCGCAACGCCTG
GGTCACGCTGGCACAGCTGCCCATGGCCCAGCTGCTGGCCGTCAAGTGCGCCAGCCCGCTCGCCTGGCTTCTCGG
CTGCGGCCCCGAGCGGCTCAGCTGGCTCCATCGCTGGGTGGCCCGCACGATGCTTGTCGTCGCCACCGTCCACGG
CTTCAGCTTCTGGACCGAGTGGGAGCGCGCCGACTTTGTCGCCTTCGAGCTGTCCGTCATGCCCATGGTCAAGTA
CGGCCTTGGTGCCTGGGCCGTGCTGCTGTGGTCCGTCGTCGCCGGCTTCCTGCCCGTCCGCCGCCTCGCCTACGA
GCTCTGGCTGCTGCAGCATCTGGCCTCGGTCGTCGCCATGCTGTGGCTGCTGTACCGGCACATCCCGGCCTCGGC
CCGCTACCTGCTCTGGATGACCGTCGGTCTTCTCGCCTATGATCGCCTCGCCCGCTGGCTGCTGCTGCTGCGGCG
CAACTTGCACTGGTCCTTGCTCTTCGCCTTCTTTCCCTCTTCTTCCTCTTCCTCCTCCTTGTCGACGAACCGTCG
CCGGCGCCTCGGCCGCTTCGGTCACGAAATGTCGATTCGAGCCGTCGGCGATGTCCTCACTGTCCTGACCATTCG
AGACGTTAGTTTCAAGTGGTGCCCCGGCCAGCACGTCTACCTCTGGGTTCCGCGCCTCGGGCCGCTCGAAGCTCA
TCCGTACACGATAGGCTGCGCTCCGGCTCATGGGCCGAACAACGACGGCTTTCGGCTCGTTGTCCGGACCCATGC
CGGGTTCTCAAAGCGTATCCACGACTACGCGTCCCGACACCCAGAGCGGACCCTCATGGCCTTCCTCTCGGGGCC
GTACGGAGTTCCGCCCCGGCTGGACACGTACGAGACGCTCGTCCTCATCGGCGCCTCCACGGGCGCGAGCTTCGT
CGTCCCCATGCTGGAGAGCATCGCGATGGCCCCGGGCAGGACGTGCGTACGCAGCGTCGACGTGGCCCTCATCGC
CCGGACGACCGCCGAGATCGGCGCCTACCTACGACAGACCAAGGACGCCAGCAGACGGGCACGCGACCGGGGCAT
GCGCGTGCGACTCCACGTCGCCATCACGGCCGAGGCCGGCGTGCCTCTGGTTCGGATGCGCCGGCCGAGAGACGC
CGGCCGTGCGGAAAAGGTGGAAACCGACGACGACGACGCCATCGAACCCTTCCCCCAGCCCGAAGAGACGACTGG
CTTCCGGCAAAGAAGTGGCAGCCGGAGCCCATCGCCGACAGGCCGTTCTCGGGGGAGCAGCCTGGGCGATCTCGA
CTTCGTGCACGAATACGTGGCAAGGCCCGACATCGAGGCTCTGGTCCGGCAGCCCGTAGAGCAGGCATGGGGCGA
AACGGCCGTCGTCGTCTGCGGTGGCGCGGAGCTCGTGGCGAGGACACGCAACTGCGTCAGCCGTTTGAGCGACGA
GAGGGCTGTCCACAAGGGCACTGGCGCCCAGGGCATCTACCTCTATGTCGAGGAGTATGCCTTTTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail