Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10109
Gene name
LocationContig_79:20563..23302
Strand-
Gene length (bp)2739
Transcript length (bp)2739
Coding sequence length (bp)2739
Protein length (aa) 913

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03169 OPT OPT oligopeptide transporter protein 7.4E-149 121 862

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40900|ISP4_SCHPO Sexual differentiation process protein isp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isp4 PE=2 SV=2 362 886 2.0E-99
sp|O23482|OPT3_ARATH Oligopeptide transporter 3 OS=Arabidopsis thaliana GN=OPT3 PE=2 SV=3 350 877 6.0E-88
sp|O14031|PGT1_SCHPO Glutathione transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pgt1 PE=1 SV=1 359 883 6.0E-85
sp|Q06593|OPT2_YEAST Oligopeptide transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT2 PE=1 SV=1 360 887 8.0E-85
sp|P40897|OPT1_YEAST Oligopeptide transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT1 PE=1 SV=1 351 884 5.0E-81
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40900|ISP4_SCHPO Sexual differentiation process protein isp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isp4 PE=2 SV=2 362 886 2.0E-99
sp|O23482|OPT3_ARATH Oligopeptide transporter 3 OS=Arabidopsis thaliana GN=OPT3 PE=2 SV=3 350 877 6.0E-88
sp|O14031|PGT1_SCHPO Glutathione transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pgt1 PE=1 SV=1 359 883 6.0E-85
sp|Q06593|OPT2_YEAST Oligopeptide transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT2 PE=1 SV=1 360 887 8.0E-85
sp|P40897|OPT1_YEAST Oligopeptide transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT1 PE=1 SV=1 351 884 5.0E-81
sp|Q9FJD1|OPT8_ARATH Oligopeptide transporter 8 OS=Arabidopsis thaliana GN=OPT8 PE=2 SV=1 368 896 2.0E-80
sp|O04514|OPT2_ARATH Oligopeptide transporter 2 OS=Arabidopsis thaliana GN=OPT2 PE=2 SV=2 368 876 7.0E-80
sp|Q9FG72|OPT1_ARATH Oligopeptide transporter 1 OS=Arabidopsis thaliana GN=OPT1 PE=2 SV=1 350 874 5.0E-79
sp|Q9SUA4|OPT5_ARATH Oligopeptide transporter 5 OS=Arabidopsis thaliana GN=OPT5 PE=2 SV=1 350 876 1.0E-77
sp|Q9FME8|OPT4_ARATH Oligopeptide transporter 4 OS=Arabidopsis thaliana GN=OPT4 PE=1 SV=1 368 896 2.0E-74
sp|Q9T095|OPT6_ARATH Oligopeptide transporter 6 OS=Arabidopsis thaliana GN=OPT6 PE=2 SV=1 350 875 2.0E-74
sp|O82485|OPT7_ARATH Oligopeptide transporter 7 OS=Arabidopsis thaliana GN=OPT7 PE=2 SV=1 350 877 2.0E-72
sp|Q9FJD2|OPT9_ARATH Oligopeptide transporter 9 OS=Arabidopsis thaliana GN=OPT9 PE=2 SV=1 368 893 3.0E-67
sp|Q7LL00|YQJC_SCHPO Uncharacterized oligopeptide transporter C1840.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1840.12 PE=3 SV=2 367 905 7.0E-48
sp|P40900|ISP4_SCHPO Sexual differentiation process protein isp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isp4 PE=2 SV=2 37 285 2.0E-29
sp|Q9FME8|OPT4_ARATH Oligopeptide transporter 4 OS=Arabidopsis thaliana GN=OPT4 PE=1 SV=1 97 286 4.0E-29
sp|O04514|OPT2_ARATH Oligopeptide transporter 2 OS=Arabidopsis thaliana GN=OPT2 PE=2 SV=2 77 287 7.0E-28
sp|Q9SUA4|OPT5_ARATH Oligopeptide transporter 5 OS=Arabidopsis thaliana GN=OPT5 PE=2 SV=1 99 296 1.0E-27
sp|Q9FG72|OPT1_ARATH Oligopeptide transporter 1 OS=Arabidopsis thaliana GN=OPT1 PE=2 SV=1 79 286 3.0E-27
sp|O23482|OPT3_ARATH Oligopeptide transporter 3 OS=Arabidopsis thaliana GN=OPT3 PE=2 SV=3 82 286 1.0E-26
sp|O14031|PGT1_SCHPO Glutathione transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pgt1 PE=1 SV=1 59 289 1.0E-26
sp|Q06593|OPT2_YEAST Oligopeptide transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT2 PE=1 SV=1 78 298 2.0E-26
sp|Q9FJD1|OPT8_ARATH Oligopeptide transporter 8 OS=Arabidopsis thaliana GN=OPT8 PE=2 SV=1 89 286 2.0E-24
sp|O82485|OPT7_ARATH Oligopeptide transporter 7 OS=Arabidopsis thaliana GN=OPT7 PE=2 SV=1 105 304 2.0E-23
sp|Q9FJD2|OPT9_ARATH Oligopeptide transporter 9 OS=Arabidopsis thaliana GN=OPT9 PE=2 SV=1 78 281 8.0E-23
sp|P40897|OPT1_YEAST Oligopeptide transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT1 PE=1 SV=1 100 281 1.0E-21
sp|Q9T095|OPT6_ARATH Oligopeptide transporter 6 OS=Arabidopsis thaliana GN=OPT6 PE=2 SV=1 85 304 2.0E-21
sp|Q7LL00|YQJC_SCHPO Uncharacterized oligopeptide transporter C1840.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1840.12 PE=3 SV=2 74 298 5.0E-19
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 54 0.45

Transmembrane Domains

Domain # Start End Length
1 374 396 22
2 411 433 22
3 446 468 22
4 526 548 22
5 586 608 22
6 613 635 22
7 642 664 22
8 694 716 22
9 761 783 22
10 812 829 17
11 841 863 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10109
MGGEQKNTPADSACTSTARTDASFYEAELVAALQELIEEHELDQNFPRELLTRARNFVRGRKDGGRGGAAGMGRE
TAEEVEEARRLVDDFREHKELERNSSAYVEVRAVVDTTDDPTTPVATFRVLVMGSIFAVAGTAMHQFFSLRMPSI
HLSTYVVQLLSMPLGKAMARWLPRGRQPLGFSLNPGPFSQKEHLLIAMMANVAFGSHHNGAYITSIVQVLKLDRF
YGEKVLANSIPWQLVTLISTQLMGYGCAGLARRFLVYPPAMIWQKALANIALTKALMRDDEGGDDDDNEGRARTA
ATRTAADTASNGGGARGEKEEGEGEPKAPATPSSSSDGGPAGPKVAEPHHSKESGARARGRGRGWTTMSRYRFFR
FCFCAMFAWHFVPNYLFQGLGLSNWPTWAAPGNVRLALIAGSTCGLGLNPLPTLDWNVATYLGDPIVTPLFTLLN
FAAGMAVAGFVAAPALYFGNAWNGGHLPINSNKMYDNQAQLYQVHRILGRGGGEGALRLDEAAYRAYSVPWLSTT
QLLNMAAYFTMYVAVPVHVGLWFRRDLAAGLRSAWRRRSRAQQFDDVHNRLMSAYPECPHWWYLAVLGASFALAC
VAVTAWPTGMPVWGIVLAVVFTVLLQVPIGMLAAITNVEIPTSILAMLIGGYALEGRVVANMLFKMFSFMSTSQS
LSFVADLKMAHYARIPPRWAFAAQVYATFVAGLVAWAVNHWSLRNIEAVCREGQPDRFVCPHTHSYFLSSVLWGV
IGPRRIFGPGGPYRALTYCLPLGLVLPVAVYLASRRWPNSWWRNANAPIFIAGPLGWSPYNWSYIQGSLVLALFF
NHFVKRRHPAWWERYAYVLTSSFAAATGLAALVLFFALQKWDIRLDWWGNRIAAQGVDQGGWRDAAGVKVNCTNL
SLPPGGHFSSGF*
Coding >Hirsu2|10109
ATGGGCGGCGAGCAGAAGAATACGCCGGCGGACAGCGCATGCACTTCGACGGCCAGGACAGACGCATCGTTCTAC
GAGGCCGAGCTCGTAGCGGCGCTGCAGGAACTAATCGAGGAGCACGAGCTGGACCAAAACTTTCCGCGTGAGCTA
CTGACACGGGCGCGGAACTTCGTGCGCGGCCGCAAGGATGGGGGCCGGGGAGGAGCAGCCGGGATGGGGAGGGAG
ACGGCGGAGGAGGTGGAGGAGGCGCGGCGGCTGGTGGACGACTTCCGGGAACACAAGGAGCTGGAGCGCAACAGC
TCGGCGTACGTCGAGGTGCGGGCCGTGGTGGACACGACGGACGACCCGACGACGCCGGTGGCCACGTTCCGGGTG
CTGGTCATGGGCAGCATCTTCGCCGTGGCCGGCACGGCCATGCACCAGTTCTTCTCGCTGCGCATGCCCAGCATC
CACCTGTCGACCTACGTCGTGCAGCTGCTGTCGATGCCGCTGGGCAAGGCCATGGCGCGCTGGCTGCCGCGGGGG
CGGCAGCCGCTCGGCTTCAGCCTCAACCCGGGCCCGTTCAGCCAGAAGGAGCACCTGCTGATCGCCATGATGGCC
AACGTCGCCTTCGGCAGCCACCATAACGGCGCCTACATCACGTCCATCGTCCAGGTGCTCAAGCTGGACCGCTTC
TACGGCGAGAAGGTGCTGGCCAACAGCATCCCGTGGCAGCTGGTGACGCTGATCTCGACCCAGCTCATGGGCTAC
GGCTGCGCCGGCCTGGCCCGCCGCTTCCTCGTGTACCCGCCAGCCATGATCTGGCAGAAGGCGCTGGCCAACATT
GCGCTGACCAAGGCCCTGATGCGCGACGACGAAGGCGGCGACGACGACGACAACGAAGGCCGGGCCAGAACGGCG
GCAACAAGGACGGCGGCGGACACGGCCTCTAACGGAGGAGGAGCCAGGGGTGAAAAGGAAGAAGGAGAAGGAGAG
CCGAAAGCCCCGGCCACGCCGTCGTCGTCGTCGGACGGCGGCCCGGCGGGGCCGAAGGTGGCCGAGCCCCACCAC
AGCAAGGAAAGCGGGGCTCGGGCCCGGGGCCGGGGCCGGGGATGGACGACGATGTCGCGGTACCGCTTCTTCCGC
TTCTGCTTCTGCGCCATGTTCGCCTGGCACTTCGTGCCCAACTATCTGTTCCAGGGGCTCGGGCTGTCCAACTGG
CCGACGTGGGCGGCGCCGGGCAACGTGCGGCTGGCGCTCATCGCCGGCAGCACGTGCGGGCTGGGGCTCAACCCG
CTGCCGACGCTGGACTGGAATGTGGCGACGTACCTGGGCGACCCGATCGTGACGCCGCTCTTCACCCTGCTCAAC
TTCGCGGCCGGCATGGCGGTGGCCGGGTTCGTGGCGGCGCCGGCGCTGTACTTCGGCAACGCCTGGAACGGCGGC
CACCTGCCGATCAACAGCAACAAGATGTACGACAACCAGGCGCAGCTGTACCAGGTGCACCGCATCCTCGGCCGG
GGCGGCGGCGAGGGCGCGCTGCGGCTGGACGAGGCGGCCTACCGGGCGTACAGCGTGCCGTGGCTGTCGACGACG
CAGCTGCTCAACATGGCGGCCTACTTCACCATGTACGTGGCGGTGCCGGTGCACGTCGGGCTCTGGTTCCGGCGC
GACCTCGCGGCCGGGCTCCGGTCGGCGTGGCGGCGGCGCAGCCGGGCGCAGCAGTTCGACGACGTGCACAACCGG
CTCATGTCGGCCTACCCGGAGTGTCCGCACTGGTGGTACCTGGCGGTGCTGGGGGCGTCGTTCGCGCTGGCGTGC
GTGGCGGTGACGGCGTGGCCGACGGGGATGCCCGTCTGGGGCATCGTCCTGGCCGTCGTCTTCACCGTGCTGCTG
CAGGTGCCGATCGGGATGCTGGCGGCCATCACCAATGTCGAGATCCCGACCAGCATCCTGGCGATGCTGATCGGC
GGCTACGCTCTCGAGGGCCGGGTCGTGGCCAACATGCTGTTCAAGATGTTCAGCTTCATGTCGACGTCGCAGTCG
CTCAGCTTCGTGGCCGACCTCAAGATGGCGCACTACGCTCGCATCCCGCCGCGCTGGGCCTTCGCCGCCCAGGTC
TACGCCACCTTCGTCGCCGGCCTCGTCGCCTGGGCCGTCAACCACTGGAGCCTGCGCAACATCGAGGCCGTCTGC
CGCGAGGGCCAGCCCGACCGCTTCGTCTGCCCGCACACGCACTCGTACTTCCTCTCCTCCGTCCTGTGGGGCGTC
ATCGGCCCGCGCCGCATCTTCGGCCCCGGCGGGCCCTACCGCGCCCTGACCTACTGCCTGCCACTCGGGCTCGTC
CTGCCCGTCGCCGTCTACCTGGCCTCGCGCCGCTGGCCCAACTCGTGGTGGCGCAACGCCAACGCGCCCATCTTC
ATCGCCGGCCCGCTCGGCTGGTCGCCCTACAACTGGAGCTACATCCAAGGCAGCCTCGTCCTCGCCCTCTTCTTC
AACCACTTCGTCAAGCGTCGCCACCCGGCCTGGTGGGAGCGCTACGCCTACGTCCTGACCAGCTCCTTCGCCGCC
GCCACCGGCCTCGCCGCCCTCGTCCTCTTCTTCGCCCTGCAGAAGTGGGACATCCGCCTCGACTGGTGGGGGAAC
CGCATTGCCGCCCAGGGCGTCGACCAGGGCGGCTGGCGGGACGCCGCTGGTGTCAAGGTCAACTGCACCAACCTG
TCGCTGCCGCCGGGCGGCCACTTCAGCTCCGGCTTCTGA
Transcript >Hirsu2|10109
ATGGGCGGCGAGCAGAAGAATACGCCGGCGGACAGCGCATGCACTTCGACGGCCAGGACAGACGCATCGTTCTAC
GAGGCCGAGCTCGTAGCGGCGCTGCAGGAACTAATCGAGGAGCACGAGCTGGACCAAAACTTTCCGCGTGAGCTA
CTGACACGGGCGCGGAACTTCGTGCGCGGCCGCAAGGATGGGGGCCGGGGAGGAGCAGCCGGGATGGGGAGGGAG
ACGGCGGAGGAGGTGGAGGAGGCGCGGCGGCTGGTGGACGACTTCCGGGAACACAAGGAGCTGGAGCGCAACAGC
TCGGCGTACGTCGAGGTGCGGGCCGTGGTGGACACGACGGACGACCCGACGACGCCGGTGGCCACGTTCCGGGTG
CTGGTCATGGGCAGCATCTTCGCCGTGGCCGGCACGGCCATGCACCAGTTCTTCTCGCTGCGCATGCCCAGCATC
CACCTGTCGACCTACGTCGTGCAGCTGCTGTCGATGCCGCTGGGCAAGGCCATGGCGCGCTGGCTGCCGCGGGGG
CGGCAGCCGCTCGGCTTCAGCCTCAACCCGGGCCCGTTCAGCCAGAAGGAGCACCTGCTGATCGCCATGATGGCC
AACGTCGCCTTCGGCAGCCACCATAACGGCGCCTACATCACGTCCATCGTCCAGGTGCTCAAGCTGGACCGCTTC
TACGGCGAGAAGGTGCTGGCCAACAGCATCCCGTGGCAGCTGGTGACGCTGATCTCGACCCAGCTCATGGGCTAC
GGCTGCGCCGGCCTGGCCCGCCGCTTCCTCGTGTACCCGCCAGCCATGATCTGGCAGAAGGCGCTGGCCAACATT
GCGCTGACCAAGGCCCTGATGCGCGACGACGAAGGCGGCGACGACGACGACAACGAAGGCCGGGCCAGAACGGCG
GCAACAAGGACGGCGGCGGACACGGCCTCTAACGGAGGAGGAGCCAGGGGTGAAAAGGAAGAAGGAGAAGGAGAG
CCGAAAGCCCCGGCCACGCCGTCGTCGTCGTCGGACGGCGGCCCGGCGGGGCCGAAGGTGGCCGAGCCCCACCAC
AGCAAGGAAAGCGGGGCTCGGGCCCGGGGCCGGGGCCGGGGATGGACGACGATGTCGCGGTACCGCTTCTTCCGC
TTCTGCTTCTGCGCCATGTTCGCCTGGCACTTCGTGCCCAACTATCTGTTCCAGGGGCTCGGGCTGTCCAACTGG
CCGACGTGGGCGGCGCCGGGCAACGTGCGGCTGGCGCTCATCGCCGGCAGCACGTGCGGGCTGGGGCTCAACCCG
CTGCCGACGCTGGACTGGAATGTGGCGACGTACCTGGGCGACCCGATCGTGACGCCGCTCTTCACCCTGCTCAAC
TTCGCGGCCGGCATGGCGGTGGCCGGGTTCGTGGCGGCGCCGGCGCTGTACTTCGGCAACGCCTGGAACGGCGGC
CACCTGCCGATCAACAGCAACAAGATGTACGACAACCAGGCGCAGCTGTACCAGGTGCACCGCATCCTCGGCCGG
GGCGGCGGCGAGGGCGCGCTGCGGCTGGACGAGGCGGCCTACCGGGCGTACAGCGTGCCGTGGCTGTCGACGACG
CAGCTGCTCAACATGGCGGCCTACTTCACCATGTACGTGGCGGTGCCGGTGCACGTCGGGCTCTGGTTCCGGCGC
GACCTCGCGGCCGGGCTCCGGTCGGCGTGGCGGCGGCGCAGCCGGGCGCAGCAGTTCGACGACGTGCACAACCGG
CTCATGTCGGCCTACCCGGAGTGTCCGCACTGGTGGTACCTGGCGGTGCTGGGGGCGTCGTTCGCGCTGGCGTGC
GTGGCGGTGACGGCGTGGCCGACGGGGATGCCCGTCTGGGGCATCGTCCTGGCCGTCGTCTTCACCGTGCTGCTG
CAGGTGCCGATCGGGATGCTGGCGGCCATCACCAATGTCGAGATCCCGACCAGCATCCTGGCGATGCTGATCGGC
GGCTACGCTCTCGAGGGCCGGGTCGTGGCCAACATGCTGTTCAAGATGTTCAGCTTCATGTCGACGTCGCAGTCG
CTCAGCTTCGTGGCCGACCTCAAGATGGCGCACTACGCTCGCATCCCGCCGCGCTGGGCCTTCGCCGCCCAGGTC
TACGCCACCTTCGTCGCCGGCCTCGTCGCCTGGGCCGTCAACCACTGGAGCCTGCGCAACATCGAGGCCGTCTGC
CGCGAGGGCCAGCCCGACCGCTTCGTCTGCCCGCACACGCACTCGTACTTCCTCTCCTCCGTCCTGTGGGGCGTC
ATCGGCCCGCGCCGCATCTTCGGCCCCGGCGGGCCCTACCGCGCCCTGACCTACTGCCTGCCACTCGGGCTCGTC
CTGCCCGTCGCCGTCTACCTGGCCTCGCGCCGCTGGCCCAACTCGTGGTGGCGCAACGCCAACGCGCCCATCTTC
ATCGCCGGCCCGCTCGGCTGGTCGCCCTACAACTGGAGCTACATCCAAGGCAGCCTCGTCCTCGCCCTCTTCTTC
AACCACTTCGTCAAGCGTCGCCACCCGGCCTGGTGGGAGCGCTACGCCTACGTCCTGACCAGCTCCTTCGCCGCC
GCCACCGGCCTCGCCGCCCTCGTCCTCTTCTTCGCCCTGCAGAAGTGGGACATCCGCCTCGACTGGTGGGGGAAC
CGCATTGCCGCCCAGGGCGTCGACCAGGGCGGCTGGCGGGACGCCGCTGGTGTCAAGGTCAACTGCACCAACCTG
TCGCTGCCGCCGGGCGGCCACTTCAGCTCCGGCTTCTGA
Gene >Hirsu2|10109
ATGGGCGGCGAGCAGAAGAATACGCCGGCGGACAGCGCATGCACTTCGACGGCCAGGACAGACGCATCGTTCTAC
GAGGCCGAGCTCGTAGCGGCGCTGCAGGAACTAATCGAGGAGCACGAGCTGGACCAAAACTTTCCGCGTGAGCTA
CTGACACGGGCGCGGAACTTCGTGCGCGGCCGCAAGGATGGGGGCCGGGGAGGAGCAGCCGGGATGGGGAGGGAG
ACGGCGGAGGAGGTGGAGGAGGCGCGGCGGCTGGTGGACGACTTCCGGGAACACAAGGAGCTGGAGCGCAACAGC
TCGGCGTACGTCGAGGTGCGGGCCGTGGTGGACACGACGGACGACCCGACGACGCCGGTGGCCACGTTCCGGGTG
CTGGTCATGGGCAGCATCTTCGCCGTGGCCGGCACGGCCATGCACCAGTTCTTCTCGCTGCGCATGCCCAGCATC
CACCTGTCGACCTACGTCGTGCAGCTGCTGTCGATGCCGCTGGGCAAGGCCATGGCGCGCTGGCTGCCGCGGGGG
CGGCAGCCGCTCGGCTTCAGCCTCAACCCGGGCCCGTTCAGCCAGAAGGAGCACCTGCTGATCGCCATGATGGCC
AACGTCGCCTTCGGCAGCCACCATAACGGCGCCTACATCACGTCCATCGTCCAGGTGCTCAAGCTGGACCGCTTC
TACGGCGAGAAGGTGCTGGCCAACAGCATCCCGTGGCAGCTGGTGACGCTGATCTCGACCCAGCTCATGGGCTAC
GGCTGCGCCGGCCTGGCCCGCCGCTTCCTCGTGTACCCGCCAGCCATGATCTGGCAGAAGGCGCTGGCCAACATT
GCGCTGACCAAGGCCCTGATGCGCGACGACGAAGGCGGCGACGACGACGACAACGAAGGCCGGGCCAGAACGGCG
GCAACAAGGACGGCGGCGGACACGGCCTCTAACGGAGGAGGAGCCAGGGGTGAAAAGGAAGAAGGAGAAGGAGAG
CCGAAAGCCCCGGCCACGCCGTCGTCGTCGTCGGACGGCGGCCCGGCGGGGCCGAAGGTGGCCGAGCCCCACCAC
AGCAAGGAAAGCGGGGCTCGGGCCCGGGGCCGGGGCCGGGGATGGACGACGATGTCGCGGTACCGCTTCTTCCGC
TTCTGCTTCTGCGCCATGTTCGCCTGGCACTTCGTGCCCAACTATCTGTTCCAGGGGCTCGGGCTGTCCAACTGG
CCGACGTGGGCGGCGCCGGGCAACGTGCGGCTGGCGCTCATCGCCGGCAGCACGTGCGGGCTGGGGCTCAACCCG
CTGCCGACGCTGGACTGGAATGTGGCGACGTACCTGGGCGACCCGATCGTGACGCCGCTCTTCACCCTGCTCAAC
TTCGCGGCCGGCATGGCGGTGGCCGGGTTCGTGGCGGCGCCGGCGCTGTACTTCGGCAACGCCTGGAACGGCGGC
CACCTGCCGATCAACAGCAACAAGATGTACGACAACCAGGCGCAGCTGTACCAGGTGCACCGCATCCTCGGCCGG
GGCGGCGGCGAGGGCGCGCTGCGGCTGGACGAGGCGGCCTACCGGGCGTACAGCGTGCCGTGGCTGTCGACGACG
CAGCTGCTCAACATGGCGGCCTACTTCACCATGTACGTGGCGGTGCCGGTGCACGTCGGGCTCTGGTTCCGGCGC
GACCTCGCGGCCGGGCTCCGGTCGGCGTGGCGGCGGCGCAGCCGGGCGCAGCAGTTCGACGACGTGCACAACCGG
CTCATGTCGGCCTACCCGGAGTGTCCGCACTGGTGGTACCTGGCGGTGCTGGGGGCGTCGTTCGCGCTGGCGTGC
GTGGCGGTGACGGCGTGGCCGACGGGGATGCCCGTCTGGGGCATCGTCCTGGCCGTCGTCTTCACCGTGCTGCTG
CAGGTGCCGATCGGGATGCTGGCGGCCATCACCAATGTCGAGATCCCGACCAGCATCCTGGCGATGCTGATCGGC
GGCTACGCTCTCGAGGGCCGGGTCGTGGCCAACATGCTGTTCAAGATGTTCAGCTTCATGTCGACGTCGCAGTCG
CTCAGCTTCGTGGCCGACCTCAAGATGGCGCACTACGCTCGCATCCCGCCGCGCTGGGCCTTCGCCGCCCAGGTC
TACGCCACCTTCGTCGCCGGCCTCGTCGCCTGGGCCGTCAACCACTGGAGCCTGCGCAACATCGAGGCCGTCTGC
CGCGAGGGCCAGCCCGACCGCTTCGTCTGCCCGCACACGCACTCGTACTTCCTCTCCTCCGTCCTGTGGGGCGTC
ATCGGCCCGCGCCGCATCTTCGGCCCCGGCGGGCCCTACCGCGCCCTGACCTACTGCCTGCCACTCGGGCTCGTC
CTGCCCGTCGCCGTCTACCTGGCCTCGCGCCGCTGGCCCAACTCGTGGTGGCGCAACGCCAACGCGCCCATCTTC
ATCGCCGGCCCGCTCGGCTGGTCGCCCTACAACTGGAGCTACATCCAAGGCAGCCTCGTCCTCGCCCTCTTCTTC
AACCACTTCGTCAAGCGTCGCCACCCGGCCTGGTGGGAGCGCTACGCCTACGTCCTGACCAGCTCCTTCGCCGCC
GCCACCGGCCTCGCCGCCCTCGTCCTCTTCTTCGCCCTGCAGAAGTGGGACATCCGCCTCGACTGGTGGGGGAAC
CGCATTGCCGCCCAGGGCGTCGACCAGGGCGGCTGGCGGGACGCCGCTGGTGTCAAGGTCAACTGCACCAACCTG
TCGCTGCCGCCGGGCGGCCACTTCAGCTCCGGCTTCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail