Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10108
Gene name
LocationContig_79:16256..18543
Strand-
Gene length (bp)2287
Transcript length (bp)2028
Coding sequence length (bp)2028
Protein length (aa) 676

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02776 TPP_enzyme_N Thiamine pyrophosphate enzyme, N-terminal TPP binding domain 3.7E-37 94 276
PF02775 TPP_enzyme_C Thiamine pyrophosphate enzyme, C-terminal TPP binding domain 1.3E-20 504 669
PF00205 TPP_enzyme_M Thiamine pyrophosphate enzyme, central domain 1.6E-09 298 404

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P20906|MDLC_PSEPU Benzoylformate decarboxylase OS=Pseudomonas putida GN=mdlC PE=1 SV=2 100 657 1.0E-27
sp|Q9HUR2|MDLC_PSEAE Benzoylformate decarboxylase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=mdlC PE=3 SV=1 94 657 1.0E-16
sp|P00893|ILVI_ECOLI Acetolactate synthase isozyme 3 large subunit OS=Escherichia coli (strain K12) GN=ilvI PE=1 SV=2 145 671 4.0E-16
sp|O61856|ILVBL_CAEEL Acetolactate synthase-like protein OS=Caenorhabditis elegans GN=T26C12.1 PE=3 SV=2 139 671 1.0E-15
sp|P40811|ILVI_SALTY Acetolactate synthase isozyme 3 large subunit OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ilvI PE=3 SV=3 141 671 4.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P20906|MDLC_PSEPU Benzoylformate decarboxylase OS=Pseudomonas putida GN=mdlC PE=1 SV=2 100 657 1.0E-27
sp|Q9HUR2|MDLC_PSEAE Benzoylformate decarboxylase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=mdlC PE=3 SV=1 94 657 1.0E-16
sp|P00893|ILVI_ECOLI Acetolactate synthase isozyme 3 large subunit OS=Escherichia coli (strain K12) GN=ilvI PE=1 SV=2 145 671 4.0E-16
sp|O61856|ILVBL_CAEEL Acetolactate synthase-like protein OS=Caenorhabditis elegans GN=T26C12.1 PE=3 SV=2 139 671 1.0E-15
sp|P40811|ILVI_SALTY Acetolactate synthase isozyme 3 large subunit OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ilvI PE=3 SV=3 141 671 4.0E-13
sp|Q57725|ILVB_METJA Probable acetolactate synthase large subunit OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=ilvB PE=3 SV=1 141 656 5.0E-13
sp|Q9P7P6|PDC3_SCHPO Probable pyruvate decarboxylase C186.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC186.09 PE=3 SV=1 105 671 2.0E-12
sp|P0CH62|CHDH_AZOSP Cyclohexane-1,2-dione hydrolase OS=Azoarcus sp. PE=1 SV=1 101 671 3.0E-12
sp|Q6NV04|ILVBL_DANRE Acetolactate synthase-like protein OS=Danio rerio GN=ilvbl PE=2 SV=1 139 671 4.0E-11
sp|P37251|ILVB_BACSU Acetolactate synthase large subunit OS=Bacillus subtilis (strain 168) GN=ilvB PE=1 SV=4 145 588 2.0E-09
sp|O08353|ILVB_METAO Probable acetolactate synthase large subunit OS=Methanococcus aeolicus GN=ilvB PE=3 SV=1 145 656 2.0E-09
sp|P27868|ILVB_ARTPT Acetolactate synthase (Fragment) OS=Arthrospira platensis GN=ilvY PE=3 SV=1 94 591 2.0E-09
sp|Q54970|POXB_STRPN Pyruvate oxidase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=spxB PE=3 SV=2 293 671 3.0E-09
sp|Q93PS3|XSC_DESTI Sulfoacetaldehyde acetyltransferase OS=Desulfonispora thiosulfatigenes GN=xsc PE=1 SV=1 94 627 1.0E-07
sp|Q7XKQ8|ILVB2_ORYSJ Probable acetolactate synthase 2, chloroplastic OS=Oryza sativa subsp. japonica GN=ALS2 PE=2 SV=2 153 657 2.0E-07
sp|Q04789|ILVX_BACSU Acetolactate synthase OS=Bacillus subtilis (strain 168) GN=alsS PE=2 SV=3 105 400 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0000287 magnesium ion binding Yes
GO:0003824 catalytic activity Yes
GO:0030976 thiamine pyrophosphate binding Yes
GO:0050662 coenzyme binding No
GO:0046872 metal ion binding No
GO:1901681 sulfur compound binding No
GO:0043169 cation binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0048037 cofactor binding No
GO:0036094 small molecule binding No
GO:0043167 ion binding No
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0043168 anion binding No
GO:0019842 vitamin binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10108
MALLRRSGLVSPAALSRCRLPIIRPAPVSSLFTGARSPPATADTASPAPPEARNATGSRPAKCLSAGNPPALAVR
HASTSALRKADPANANVYTASFAFFEAVWEAGITHCFVNLGSDHPSIIEAMVKGQREAKGKFPRIITCPNEMVAM
SMADGYARLTGKPQCVIVHVDVGTQGLGAAVHNSSTGRAPVLLFAGLSPFTLDGELRGSRTEFIHWIQDVPDQKQ
IVSQYCRYSAEIKTGTNVKQMVNRALQFAKSDPQGPVYLCGAREVMEADIEPYSLRQGDWDPVQLGGLPQRGIDS
IADALAGAERPLVVTAYGGRNHKVPGALVELANTVKGLQVVDCGGSDMCFPADHPAWRGIRFGVDDAITQADAIL
VVDCDVPWIPTLCRPRKDAKIFHVDIDPLKQQMPLFYIDAGARFRADALTSIEQLTAALKTGPAADKLRARDTTQ
AAARVEREYKELLDGIAQKAKPLEDGSFGTGYLSRTLKQMCPEDTLWAVEAVTNTGFVHNNLQPTTPGSWINCGG
GGLGWSGGGALGIKLATDAESGGKGKFVVQIVGDGTYLFSVPGSVYWISKRYKIPVLTIVLNNKGWHAPRRSLLL
VHPDGLGSKASNEEANISFDPVPDYAGIAKAAADGDVFAAKVSRASELEGVLREAIAKVQAGQTAVVDCSVVPGC
*
Coding >Hirsu2|10108
ATGGCCCTGCTCCGGCGCTCTGGACTCGTCTCACCGGCGGCCTTGTCGAGGTGCCGACTGCCGATCATCCGCCCC
GCCCCGGTCTCGTCCCTCTTCACCGGCGCCCGCAGTCCGCCCGCGACGGCCGACACGGCCTCCCCCGCCCCGCCC
GAAGCCCGAAACGCCACTGGCAGCCGACCGGCGAAATGTCTCTCGGCCGGCAACCCTCCCGCCCTGGCTGTCCGA
CACGCCTCCACTTCGGCCCTGCGGAAGGCTGACCCGGCCAACGCCAACGTCTACACGGCCTCGTTTGCCTTCTTC
GAGGCTGTCTGGGAGGCCGGCATCACCCACTGTTTTGTCAACCTCGGCTCCGATCATCCCAGCATCATCGAGGCC
ATGGTCAAGGGTCAGCGCGAGGCCAAGGGCAAATTCCCGCGCATCATCACCTGCCCAAACGAGATGGTAGCCATG
TCTATGGCAGACGGCTACGCTCGGCTGACGGGCAAGCCCCAATGCGTCATCGTCCACGTTGATGTCGGCACGCAG
GGTCTCGGGGCGGCGGTGCACAACTCGTCCACCGGCCGCGCCCCTGTCCTCCTCTTTGCTGGCCTGTCCCCCTTT
ACACTAGACGGCGAGCTCCGCGGGAGCCGTACCGAATTTATCCATTGGATCCAGGACGTGCCCGACCAGAAGCAG
ATTGTGTCCCAGTACTGCCGCTACTCGGCCGAAATTAAGACGGGAACCAATGTTAAGCAGATGGTCAACCGCGCC
CTCCAATTTGCCAAGTCGGACCCTCAAGGCCCCGTTTACCTATGCGGCGCCCGCGAGGTTATGGAGGCCGATATC
GAGCCCTACTCGCTCCGGCAGGGCGACTGGGATCCGGTGCAGCTCGGAGGCCTCCCCCAGCGCGGCATCGATAGC
ATCGCCGACGCCCTGGCCGGCGCCGAGCGCCCCCTCGTCGTGACCGCCTATGGCGGCAGGAACCACAAGGTGCCC
GGAGCCCTTGTCGAGCTCGCCAATACGGTCAAGGGTCTGCAGGTGGTGGACTGCGGGGGCAGCGATATGTGCTTT
CCGGCCGACCACCCGGCCTGGCGAGGCATCCGGTTCGGCGTCGACGATGCCATTACGCAGGCCGACGCCATCCTC
GTCGTCGACTGCGACGTGCCGTGGATCCCTACGCTGTGCAGGCCGCGCAAAGATGCCAAGATCTTCCACGTCGAC
ATCGACCCCCTTAAGCAGCAGATGCCCCTATTTTACATTGATGCGGGCGCGAGATTCCGAGCCGACGCCCTGACA
TCGATCGAGCAGTTGACGGCGGCGCTCAAGACGGGCCCGGCCGCCGACAAGCTGCGGGCGCGGGACACGACGCAG
GCGGCGGCACGGGTGGAGCGCGAGTACAAGGAGCTCCTGGACGGCATCGCGCAAAAGGCCAAGCCTCTCGAGGAC
GGCAGCTTTGGGACGGGCTACCTGTCGCGGACGCTGAAGCAGATGTGTCCCGAGGACACGCTGTGGGCCGTCGAG
GCCGTGACCAACACAGGGTTCGTGCACAACAACCTACAGCCGACGACGCCGGGGTCGTGGATCAACTGCGGCGGC
GGCGGCCTCGGCTGGTCCGGGGGCGGCGCGCTGGGCATCAAGCTCGCGACGGACGCCGAGAGCGGCGGCAAGGGC
AAGTTTGTGGTGCAGATTGTCGGGGACGGCACCTACCTGTTTTCGGTGCCGGGCAGCGTATACTGGATCTCGAAG
AGATACAAGATCCCCGTGCTGACCATTGTGCTCAACAACAAGGGATGGCACGCTCCGAGGCGGTCGCTGCTGTTG
GTGCACCCCGACGGGCTGGGGTCCAAGGCGAGCAACGAGGAAGCCAACATCTCGTTCGACCCGGTGCCGGACTAT
GCGGGCATCGCCAAGGCGGCGGCGGACGGGGACGTGTTCGCGGCCAAGGTTTCGCGGGCGTCGGAGCTGGAGGGG
GTGCTGAGGGAGGCGATTGCCAAGGTGCAGGCGGGCCAGACGGCGGTGGTGGACTGCTCGGTGGTGCCGGGCTGC
TGA
Transcript >Hirsu2|10108
ATGGCCCTGCTCCGGCGCTCTGGACTCGTCTCACCGGCGGCCTTGTCGAGGTGCCGACTGCCGATCATCCGCCCC
GCCCCGGTCTCGTCCCTCTTCACCGGCGCCCGCAGTCCGCCCGCGACGGCCGACACGGCCTCCCCCGCCCCGCCC
GAAGCCCGAAACGCCACTGGCAGCCGACCGGCGAAATGTCTCTCGGCCGGCAACCCTCCCGCCCTGGCTGTCCGA
CACGCCTCCACTTCGGCCCTGCGGAAGGCTGACCCGGCCAACGCCAACGTCTACACGGCCTCGTTTGCCTTCTTC
GAGGCTGTCTGGGAGGCCGGCATCACCCACTGTTTTGTCAACCTCGGCTCCGATCATCCCAGCATCATCGAGGCC
ATGGTCAAGGGTCAGCGCGAGGCCAAGGGCAAATTCCCGCGCATCATCACCTGCCCAAACGAGATGGTAGCCATG
TCTATGGCAGACGGCTACGCTCGGCTGACGGGCAAGCCCCAATGCGTCATCGTCCACGTTGATGTCGGCACGCAG
GGTCTCGGGGCGGCGGTGCACAACTCGTCCACCGGCCGCGCCCCTGTCCTCCTCTTTGCTGGCCTGTCCCCCTTT
ACACTAGACGGCGAGCTCCGCGGGAGCCGTACCGAATTTATCCATTGGATCCAGGACGTGCCCGACCAGAAGCAG
ATTGTGTCCCAGTACTGCCGCTACTCGGCCGAAATTAAGACGGGAACCAATGTTAAGCAGATGGTCAACCGCGCC
CTCCAATTTGCCAAGTCGGACCCTCAAGGCCCCGTTTACCTATGCGGCGCCCGCGAGGTTATGGAGGCCGATATC
GAGCCCTACTCGCTCCGGCAGGGCGACTGGGATCCGGTGCAGCTCGGAGGCCTCCCCCAGCGCGGCATCGATAGC
ATCGCCGACGCCCTGGCCGGCGCCGAGCGCCCCCTCGTCGTGACCGCCTATGGCGGCAGGAACCACAAGGTGCCC
GGAGCCCTTGTCGAGCTCGCCAATACGGTCAAGGGTCTGCAGGTGGTGGACTGCGGGGGCAGCGATATGTGCTTT
CCGGCCGACCACCCGGCCTGGCGAGGCATCCGGTTCGGCGTCGACGATGCCATTACGCAGGCCGACGCCATCCTC
GTCGTCGACTGCGACGTGCCGTGGATCCCTACGCTGTGCAGGCCGCGCAAAGATGCCAAGATCTTCCACGTCGAC
ATCGACCCCCTTAAGCAGCAGATGCCCCTATTTTACATTGATGCGGGCGCGAGATTCCGAGCCGACGCCCTGACA
TCGATCGAGCAGTTGACGGCGGCGCTCAAGACGGGCCCGGCCGCCGACAAGCTGCGGGCGCGGGACACGACGCAG
GCGGCGGCACGGGTGGAGCGCGAGTACAAGGAGCTCCTGGACGGCATCGCGCAAAAGGCCAAGCCTCTCGAGGAC
GGCAGCTTTGGGACGGGCTACCTGTCGCGGACGCTGAAGCAGATGTGTCCCGAGGACACGCTGTGGGCCGTCGAG
GCCGTGACCAACACAGGGTTCGTGCACAACAACCTACAGCCGACGACGCCGGGGTCGTGGATCAACTGCGGCGGC
GGCGGCCTCGGCTGGTCCGGGGGCGGCGCGCTGGGCATCAAGCTCGCGACGGACGCCGAGAGCGGCGGCAAGGGC
AAGTTTGTGGTGCAGATTGTCGGGGACGGCACCTACCTGTTTTCGGTGCCGGGCAGCGTATACTGGATCTCGAAG
AGATACAAGATCCCCGTGCTGACCATTGTGCTCAACAACAAGGGATGGCACGCTCCGAGGCGGTCGCTGCTGTTG
GTGCACCCCGACGGGCTGGGGTCCAAGGCGAGCAACGAGGAAGCCAACATCTCGTTCGACCCGGTGCCGGACTAT
GCGGGCATCGCCAAGGCGGCGGCGGACGGGGACGTGTTCGCGGCCAAGGTTTCGCGGGCGTCGGAGCTGGAGGGG
GTGCTGAGGGAGGCGATTGCCAAGGTGCAGGCGGGCCAGACGGCGGTGGTGGACTGCTCGGTGGTGCCGGGCTGC
TGA
Gene >Hirsu2|10108
ATGGCCCTGCTCCGGCGCTCTGGACTCGTCTCACCGGCGGCCTTGTCGAGGTGCCGACTGCCGATCATCCGCCCC
GCCCCGGTCTCGTCCCTCTTCACCGGCGCCCGCAGTCCGCCCGCGACGGCCGACACGGCCTCCCCCGCCCCGCCC
GAAGCCCGAAACGCCACTGGCAGCCGACCGGCGAAATGTCTCTCGGCCGGCAACCCTCCCGCCCTGGCTGTCCGA
CACGCCTCCACTTCGGCCCTGCGGAAGGCTGACCCGGCCAACGCCAACGTCTACACGGCCTCGTTTGCCTTCTTC
GAGGCTGTCTGGGAGGCCGGCATCACCCACTGTTTTGTCAACCTCGGCTCCGATCATCCCAGCATCATCGAGGCC
ATGGTCAAGGGTCAGCGCGAGGCCAAGGGCAAATTCCCGCGCATCATCACCTGCCCAAACGAGGTATGAGCCTGG
CTCACCATTTGTCCCTGACCCTGCCCCTACCCCCATGCTCCCCCGATCCGCGTCCATCTCGACAAGCAAGACCTT
GGTCTGTGGGATTCGACGAGACGGGCAGAGTGGCGCGATGAGGACTGGCCGACGGAGACTGGCTGACGCTTCCGC
CCGTACGTGTTCACGTCTAGATGGTAGCCATGTCTATGGCAGACGGCTACGCTCGGCTGACGGGCAAGCCCCAAT
GCGTCATCGTCCACGTTGATGTCGGCACGCAGGGTCTCGGGGCGGCGGTGCACAACTCGTCCACCGGCCGCGCCC
CTGTCCTCCTCTTTGCTGGCCTGTCCCCCTTTACACTAGACGGCGAGCTCCGCGGGAGCCGTACCGAATTTATCC
ATTGGATCCAGGACGTGCCCGACCAGAAGCAGATTGTGTCCCAGTACTGCCGCTACTCGGCCGAAATTAAGACGG
GAACCAATGTTAAGCAGATGGTCAACCGCGCCCTCCAATTTGCCAAGTCGGACCCTCAAGGCCCCGTTTACCTAT
GCGGCGCCCGCGAGGTTATGGAGGCCGATATCGAGCCCTACTCGCTCCGGCAGGGCGACTGGGATCCGGTGCAGC
TCGGAGGCCTCCCCCAGCGCGGCATCGATAGCATCGCCGACGCCCTGGCCGGCGCCGAGCGCCCCCTCGTCGTGA
CCGCCTATGGCGGCAGGAACCACAAGGTGCCCGGAGCCCTTGTCGAGCTCGCCAATACGGTCAAGGGTCTGCAGG
TGGTGGACTGCGGGGGCAGCGATATGTGCTTTCCGGCCGACCACCCGGCCTGGCGAGGCATCCGGTTCGGCGTCG
ACGATGCCATTACGCAGGCCGACGCCATCCTCGTCGTCGACTGCGACGTGCCGTGGATCCCTACGCTGTGCAGGC
CGCGCAAAGATGCCAAGATCTTCCACGTCGACATCGACCCCCTTAAGCAGCAGATGCCCCTATTTTACATTGATG
CGGGCGCGAGATTCCGAGCCGACGCCCTGACATCGATCGAGCAGTTGACGGCGGCGCTCAAGACGGGCCCGGCCG
CCGACAAGCTGCGGGCGCGGGACACGACGCAGGCGGCGGCACGGGTGGAGCGCGAGTACAAGGAGCTCCTGGACG
GCATCGCGCAAAAGGCCAAGCCTCTCGAGGACGGCAGCTTTGGGACGGGCTACCTGTCGCGGACGCTGAAGCAGA
TGTGTCCCGAGGACACGCTGTGGGCCGTCGAGGCCGTGACCAACACAGGGTTCGTGCACAACAACCTACAGCCGA
CGACGCCGGGGTCGTGGATCAACTGCGGCGGCGGCGGCCTCGGCTGGTCCGGGGGCGGCGCGCTGGGCATCAAGC
TCGCGACGGACGCCGAGAGCGGCGGCAAGGGCAAGTTTGTGGTGCAGATTGTCGGGGACGGCACCTACCTGTTTT
CGGTGCCGGGCAGCGTATACTGGATCTCGAAGAGATACAAGATCCCCGTGCTGACCATTGTGCTCAACAACAAGG
GTGAGTCTTGTCCGTCGTCGTGGCCGTCGAAGGCGGGTGGTGAGAGATGCTGATGACTGTGCCCTACTTTCTTGC
AGGATGGCACGCTCCGAGGCGGTCGCTGCTGTTGGTGCACCCCGACGGGCTGGGGTCCAAGGCGAGCAACGAGGA
AGCCAACATCTCGTTCGACCCGGTGCCGGACTATGCGGGCATCGCCAAGGCGGCGGCGGACGGGGACGTGTTCGC
GGCCAAGGTTTCGCGGGCGTCGGAGCTGGAGGGGGTGCTGAGGGAGGCGATTGCCAAGGTGCAGGCGGGCCAGAC
GGCGGTGGTGGACTGCTCGGTGGTGCCGGGCTGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail