Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10102
Gene name
LocationContig_79:6121..7010
Strand-
Gene length (bp)889
Transcript length (bp)744
Coding sequence length (bp)744
Protein length (aa) 248

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08590 DUF1771 Domain of unknown function (DUF1771) 6.8E-25 21 84
PF01713 Smr Smr domain 2.3E-09 94 151

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9UTP4|YLL3_SCHPO Smr domain-containing protein C11H11.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11H11.03c PE=3 SV=1 20 247 3.0E-38
sp|Q08954|YP199_YEAST Smr domain-containing protein YPL199C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPL199C PE=1 SV=1 14 170 7.0E-25
sp|Q86UW6|N4BP2_HUMAN NEDD4-binding protein 2 OS=Homo sapiens GN=N4BP2 PE=1 SV=2 20 144 1.0E-14
sp|O64843|CID7_ARATH Polyadenylate-binding protein-interacting protein 7 OS=Arabidopsis thaliana GN=CID7 PE=1 SV=1 15 166 6.0E-12

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10102
MARLGGRALHSGDNDEAEHEYDRLRDMARAEADKRNSCFDRSRQAYKSGDGAGAKVLSNQGKMHDAKMDEYNRQA
SDYIFRENNAPGKVEPDAIDLHGQFVEEAERILEQRIRADQARGQTHLHAIVGKGHHSAGHVQKIKPKVEELCRE
LGLKYRTEENAGRIYINLQGGEPITPQHHGGGGGQHHGGGHAAHPGGHQQPPQHHGNQPHHGNQQQGNQQQDDIA
QLVEKALPRIMRKLEKACCVVM*
Coding >Hirsu2|10102
ATGGCAAGATTGGGCGGCCGAGCCCTACACTCCGGCGACAACGACGAAGCCGAGCACGAATACGATCGCCTGCGC
GACATGGCGCGCGCCGAAGCCGACAAGCGCAACTCGTGCTTCGACCGGTCCCGCCAAGCGTACAAGTCGGGTGAC
GGCGCAGGCGCCAAGGTGCTGTCGAACCAGGGCAAGATGCACGACGCCAAGATGGACGAGTATAACCGCCAGGCA
TCCGACTACATCTTTCGTGAAAACAACGCGCCCGGCAAGGTCGAGCCCGACGCCATCGACCTGCACGGGCAGTTC
GTCGAGGAAGCCGAGCGCATCCTGGAGCAGCGCATCCGGGCGGACCAGGCGCGCGGCCAAACACATCTGCACGCC
ATCGTCGGCAAGGGACACCACTCGGCCGGCCACGTGCAGAAAATCAAGCCCAAGGTCGAGGAGCTGTGTCGCGAG
CTTGGCCTCAAGTACCGTACGGAGGAGAATGCGGGCCGGATATACATCAACCTCCAGGGCGGCGAGCCGATCACC
CCTCAGCACCACGGCGGCGGAGGCGGCCAGCATCACGGCGGCGGACACGCAGCGCATCCGGGCGGGCACCAGCAG
CCGCCGCAGCACCACGGGAACCAGCCGCATCACGGGAACCAGCAGCAAGGGAACCAGCAGCAGGACGACATTGCA
CAACTGGTGGAAAAGGCGCTCCCGCGCATCATGCGCAAGCTGGAAAAGGCCTGCTGCGTGGTCATGTAA
Transcript >Hirsu2|10102
ATGGCAAGATTGGGCGGCCGAGCCCTACACTCCGGCGACAACGACGAAGCCGAGCACGAATACGATCGCCTGCGC
GACATGGCGCGCGCCGAAGCCGACAAGCGCAACTCGTGCTTCGACCGGTCCCGCCAAGCGTACAAGTCGGGTGAC
GGCGCAGGCGCCAAGGTGCTGTCGAACCAGGGCAAGATGCACGACGCCAAGATGGACGAGTATAACCGCCAGGCA
TCCGACTACATCTTTCGTGAAAACAACGCGCCCGGCAAGGTCGAGCCCGACGCCATCGACCTGCACGGGCAGTTC
GTCGAGGAAGCCGAGCGCATCCTGGAGCAGCGCATCCGGGCGGACCAGGCGCGCGGCCAAACACATCTGCACGCC
ATCGTCGGCAAGGGACACCACTCGGCCGGCCACGTGCAGAAAATCAAGCCCAAGGTCGAGGAGCTGTGTCGCGAG
CTTGGCCTCAAGTACCGTACGGAGGAGAATGCGGGCCGGATATACATCAACCTCCAGGGCGGCGAGCCGATCACC
CCTCAGCACCACGGCGGCGGAGGCGGCCAGCATCACGGCGGCGGACACGCAGCGCATCCGGGCGGGCACCAGCAG
CCGCCGCAGCACCACGGGAACCAGCCGCATCACGGGAACCAGCAGCAAGGGAACCAGCAGCAGGACGACATTGCA
CAACTGGTGGAAAAGGCGCTCCCGCGCATCATGCGCAAGCTGGAAAAGGCCTGCTGCGTGGTCATGTAA
Gene >Hirsu2|10102
ATGGCAAGATTGGGCGGCCGAGGTACGATGAATGCGCCTCCAGGCCATTGAGCCCTCAAATGGAGCCCTGGATTT
CACTGACACGGCCCGACGCAGCCCTACACTCCGGCGACAACGACGAAGCCGAGCACGAATACGATCGCCTGCGCG
ACATGGCGCGCGCCGAAGCCGACAAGCGCAACTCGTGCTTCGACCGGGTAGGGACACCGGGCGCGCACACAATTG
CACGTTGCGGGCGGCCGGCTGACTCGAATATTGTTTTTCACAGTCCCGCCAAGCGTACAAGTCGGGTGACGGCGC
AGGCGCCAAGGTGCTGTCGAACCAGGGCAAGATGCACGACGCCAAGATGGACGAGTATAACCGCCAGGCATCCGA
CTACATCTTTCGTGAAAACAACGCGCCCGGCAAGGTCGAGCCCGACGCCATCGACCTGCACGGGCAGTTCGTCGA
GGAAGCCGAGCGCATCCTGGAGCAGCGCATCCGGGCGGACCAGGCGCGCGGCCAAACACATCTGCACGCCATCGT
CGGCAAGGGACACCACTCGGCCGGCCACGTGCAGAAAATCAAGCCCAAGGTCGAGGAGCTGTGTCGCGAGCTTGG
CCTCAAGTACCGTACGGAGGAGAATGCGGGCCGGATATACATCAACCTCCAGGGCGGCGAGCCGATCACCCCTCA
GCACCACGGCGGCGGAGGCGGCCAGCATCACGGCGGCGGACACGCAGCGCATCCGGGCGGGCACCAGCAGCCGCC
GCAGCACCACGGGAACCAGCCGCATCACGGGAACCAGCAGCAAGGGAACCAGCAGCAGGACGACATTGCACAACT
GGTGGAAAAGGCGCTCCCGCGCATCATGCGCAAGCTGGAAAAGGCCTGCTGCGTGGTCATGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail