Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10098
Gene name
LocationContig_789:8118..8882
Strand-
Gene length (bp)764
Transcript length (bp)702
Coding sequence length (bp)702
Protein length (aa) 234

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03232 COQ7 Ubiquinone biosynthesis protein COQ7 1.2E-70 53 233

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P41735|COQ7_YEAST 5-demethoxyubiquinone hydroxylase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAT5 PE=1 SV=2 17 233 8.0E-57
sp|O74826|COQ7_SCHPO 5-demethoxyubiquinone hydroxylase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=coq7 PE=3 SV=1 42 233 7.0E-50
sp|Q99807|COQ7_HUMAN 5-demethoxyubiquinone hydroxylase, mitochondrial OS=Homo sapiens GN=COQ7 PE=1 SV=3 57 233 7.0E-44
sp|Q2TBW2|COQ7_BOVIN 5-demethoxyubiquinone hydroxylase, mitochondrial OS=Bos taurus GN=COQ7 PE=2 SV=1 49 233 8.0E-43
sp|Q54VB3|COQ7_DICDI 5-demethoxyubiquinone hydroxylase, mitochondrial OS=Dictyostelium discoideum GN=coq7 PE=2 SV=1 49 233 9.0E-43
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P41735|COQ7_YEAST 5-demethoxyubiquinone hydroxylase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAT5 PE=1 SV=2 17 233 8.0E-57
sp|O74826|COQ7_SCHPO 5-demethoxyubiquinone hydroxylase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=coq7 PE=3 SV=1 42 233 7.0E-50
sp|Q99807|COQ7_HUMAN 5-demethoxyubiquinone hydroxylase, mitochondrial OS=Homo sapiens GN=COQ7 PE=1 SV=3 57 233 7.0E-44
sp|Q2TBW2|COQ7_BOVIN 5-demethoxyubiquinone hydroxylase, mitochondrial OS=Bos taurus GN=COQ7 PE=2 SV=1 49 233 8.0E-43
sp|Q54VB3|COQ7_DICDI 5-demethoxyubiquinone hydroxylase, mitochondrial OS=Dictyostelium discoideum GN=coq7 PE=2 SV=1 49 233 9.0E-43
sp|P97478|COQ7_MOUSE 5-demethoxyubiquinone hydroxylase, mitochondrial OS=Mus musculus GN=Coq7 PE=1 SV=3 57 232 9.0E-43
sp|Q63619|COQ7_RAT 5-demethoxyubiquinone hydroxylase, mitochondrial (Fragment) OS=Rattus norvegicus GN=Coq7 PE=2 SV=3 57 232 2.0E-41
sp|P48376|COQ7_CAEEL 5-demethoxyubiquinone hydroxylase, mitochondrial OS=Caenorhabditis elegans GN=clk-1 PE=1 SV=1 47 233 9.0E-33
sp|Q47IC7|COQ7_DECAR 2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase OS=Dechloromonas aromatica (strain RCB) GN=coq7 PE=3 SV=1 45 206 7.0E-12
sp|A1W3V1|COQ7_ACISJ 2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase OS=Acidovorax sp. (strain JS42) GN=coq7 PE=3 SV=1 17 194 1.0E-11
sp|B3R6W9|COQ7_CUPTR 2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=coq7 PE=3 SV=1 45 203 1.0E-11
sp|B9MDA8|COQ7_ACIET 2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase OS=Acidovorax ebreus (strain TPSY) GN=coq7 PE=3 SV=1 17 194 2.0E-11
sp|B2UCY7|COQ7_RALPJ 2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase OS=Ralstonia pickettii (strain 12J) GN=coq7 PE=3 SV=1 13 201 2.0E-10
sp|Q0K6L4|COQ7_CUPNH 2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=coq7 PE=3 SV=1 45 197 2.0E-09
sp|Q7NSP9|COQ7_CHRVO 2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=coq7 PE=3 SV=1 45 203 6.0E-09
sp|A1TKP1|COQ7_ACIAC 2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase OS=Acidovorax citrulli (strain AAC00-1) GN=coq7 PE=3 SV=1 29 172 7.0E-09
sp|Q13TY2|COQ7_BURXL 2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase OS=Burkholderia xenovorans (strain LB400) GN=coq7 PE=3 SV=1 45 203 7.0E-09
sp|Q8XVH7|COQ7_RALSO 2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase OS=Ralstonia solanacearum (strain GMI1000) GN=coq7 PE=3 SV=1 45 201 1.0E-08
sp|Q1LIL6|COQ7_CUPMC 2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=coq7 PE=3 SV=1 35 201 3.0E-08
sp|Q46WY4|COQ7_CUPPJ 2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=coq7 PE=3 SV=1 45 226 4.0E-08
sp|Q4K507|COQ7_PSEF5 2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=coq7 PE=3 SV=1 45 162 4.0E-08
sp|Q7W1A7|COQ7_BORPA 2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=coq7 PE=3 SV=2 45 162 2.0E-07
sp|Q7WP11|COQ7_BORBR 2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=coq7 PE=3 SV=1 45 162 2.0E-07
sp|A9I769|COQ7_BORPD 2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=coq7 PE=3 SV=1 44 168 3.0E-07
sp|A4SV64|COQ7_POLSQ 2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=coq7 PE=3 SV=1 45 162 3.0E-07
sp|A5WDY5|COQ7_PSYWF 2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase OS=Psychrobacter sp. (strain PRwf-1) GN=coq7 PE=3 SV=1 1 233 3.0E-07
sp|B2SYY5|COQ7_BURPP 2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=coq7 PE=3 SV=1 29 162 4.0E-07
sp|A5VXM0|COQ7_PSEP1 2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=coq7 PE=3 SV=1 45 162 4.0E-07
sp|B4E6K2|COQ7_BURCJ 2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=coq7 PE=3 SV=1 45 162 4.0E-07
sp|Q1IFZ3|COQ7_PSEE4 2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase OS=Pseudomonas entomophila (strain L48) GN=coq7 PE=3 SV=1 45 203 5.0E-07
sp|A9AJ26|COQ7_BURM1 2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=coq7 PE=3 SV=1 45 162 5.0E-07
sp|Q88QR1|COQ7_PSEPK 2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase OS=Pseudomonas putida (strain KT2440) GN=coq7 PE=3 SV=1 45 162 5.0E-07
sp|B0KK40|COQ7_PSEPG 2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase OS=Pseudomonas putida (strain GB-1) GN=coq7 PE=3 SV=1 45 162 8.0E-07
sp|Q0BIL1|COQ7_BURCM 2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=coq7 PE=3 SV=1 45 162 9.0E-07
sp|B1YSR4|COQ7_BURA4 2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase OS=Burkholderia ambifaria (strain MC40-6) GN=coq7 PE=3 SV=1 45 162 1.0E-06
sp|A4XZC2|COQ7_PSEMY 2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase OS=Pseudomonas mendocina (strain ymp) GN=coq7 PE=3 SV=1 45 171 1.0E-06
sp|A0K476|COQ7_BURCH 2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase OS=Burkholderia cenocepacia (strain HI2424) GN=coq7 PE=3 SV=1 45 162 1.0E-06
sp|B1JUW2|COQ7_BURCC 2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase OS=Burkholderia cenocepacia (strain MC0-3) GN=coq7 PE=3 SV=1 45 162 1.0E-06
sp|Q1BZH3|COQ7_BURCA 2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase OS=Burkholderia cenocepacia (strain AU 1054) GN=coq7 PE=3 SV=1 45 162 1.0E-06
sp|C5CPL7|COQ7_VARPS 2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase OS=Variovorax paradoxus (strain S110) GN=coq7 PE=3 SV=1 45 159 2.0E-06
sp|Q39JY0|COQ7_BURL3 2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=coq7 PE=3 SV=1 45 162 2.0E-06
sp|B1JE29|COQ7_PSEPW 2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase OS=Pseudomonas putida (strain W619) GN=coq7 PE=3 SV=1 45 203 2.0E-06
sp|C1DHY3|COQ7_AZOVD 2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=coq7 PE=3 SV=1 53 164 2.0E-06
sp|Q62GR7|COQ7_BURMA 2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase OS=Burkholderia mallei (strain ATCC 23344) GN=coq7 PE=3 SV=1 49 162 3.0E-06
sp|Q4UZF3|COQ7_XANC8 2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=coq7 PE=3 SV=1 10 211 3.0E-06
sp|Q8PD67|COQ7_XANCP 2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=coq7 PE=3 SV=1 10 211 3.0E-06
sp|A3NDX4|COQ7_BURP6 2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase OS=Burkholderia pseudomallei (strain 668) GN=coq7 PE=3 SV=1 49 162 3.0E-06
sp|A2SKI7|COQ7_METPP 2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase OS=Methylibium petroleiphilum (strain PM1) GN=coq7 PE=3 SV=1 45 154 3.0E-06
sp|A3MR53|COQ7_BURM7 2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase OS=Burkholderia mallei (strain NCTC 10247) GN=coq7 PE=3 SV=1 49 162 3.0E-06
sp|A2S5V5|COQ7_BURM9 2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase OS=Burkholderia mallei (strain NCTC 10229) GN=coq7 PE=3 SV=2 49 162 3.0E-06
sp|A1V0S8|COQ7_BURMS 2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase OS=Burkholderia mallei (strain SAVP1) GN=coq7 PE=3 SV=2 49 162 3.0E-06
sp|A9BXN5|COQ7_DELAS 2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=coq7 PE=3 SV=1 29 172 4.0E-06
sp|Q48NP2|COQ7_PSE14 2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=coq7 PE=3 SV=1 57 162 4.0E-06
sp|Q63QI7|COQ7_BURPS 2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase OS=Burkholderia pseudomallei (strain K96243) GN=coq7 PE=3 SV=1 49 162 4.0E-06
sp|Q3JNC9|COQ7_BURP1 2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase OS=Burkholderia pseudomallei (strain 1710b) GN=coq7 PE=3 SV=1 49 162 4.0E-06
sp|A3NZM5|COQ7_BURP0 2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase OS=Burkholderia pseudomallei (strain 1106a) GN=coq7 PE=3 SV=1 49 162 4.0E-06
sp|Q889Z8|COQ7_PSESM 2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=coq7 PE=3 SV=1 53 162 5.0E-06
sp|Q6F9T3|COQ7_ACIAD 2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=coq7 PE=3 SV=1 39 162 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006744 ubiquinone biosynthetic process Yes
GO:0055114 oxidation-reduction process Yes
GO:0044237 cellular metabolic process No
GO:0008150 biological_process No
GO:0006743 ubiquinone metabolic process No
GO:0008152 metabolic process No
GO:0009108 coenzyme biosynthetic process No
GO:0006732 coenzyme metabolic process No
GO:0071704 organic substance metabolic process No
GO:0051188 cofactor biosynthetic process No
GO:0044283 small molecule biosynthetic process No
GO:0042180 cellular ketone metabolic process No
GO:0006733 oxidoreduction coenzyme metabolic process No
GO:1901663 quinone biosynthetic process No
GO:1901661 quinone metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0009058 biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0042181 ketone biosynthetic process No
GO:0044281 small molecule metabolic process No
GO:0051186 cofactor metabolic process No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10098
MASTRSLARRVPPGPSTRLVCARPAARAFSTPTAADEKKKKRRPLTAEQRDFLSSALRVNQAGELAATLIYQAQT
PLLVRRHPHLRPLMRHMYEQEAGHLATFNALLHRHRVRPTALYPLWSVLASGLGWATAAMGREAAMACTEAVETE
IGDHYNGQIRTLLETVARWEADGEDPGPEILDLIDTLRRIRDEELEHLDHAVEHDAKKAQPHWLLTNAIRAGCRG
AIWLSERV*
Coding >Hirsu2|10098
ATGGCCTCGACGCGCAGCCTCGCCCGCCGCGTCCCCCCCGGGCCGTCGACGAGGCTGGTCTGCGCCCGCCCAGCA
GCGCGCGCCTTCTCGACCCCGACAGCCGCCGACGAGAAGAAGAAGAAGCGCAGGCCGCTCACCGCGGAGCAGCGC
GACTTTCTCTCCTCCGCTCTGCGCGTCAACCAGGCGGGCGAGCTCGCCGCGACGCTCATCTACCAGGCGCAGACG
CCGCTCCTCGTCCGGCGGCACCCACACCTGCGGCCGCTGATGCGGCACATGTACGAGCAGGAGGCCGGCCACCTG
GCGACGTTCAACGCGCTGCTGCACCGGCACCGCGTCCGCCCCACGGCCCTGTACCCGCTCTGGTCCGTCCTGGCC
TCGGGCCTCGGCTGGGCCACGGCCGCCATGGGCCGCGAGGCCGCCATGGCCTGCACCGAGGCCGTCGAGACGGAG
ATCGGCGACCACTACAACGGCCAGATCCGCACCCTGCTCGAGACCGTCGCCCGCTGGGAGGCCGACGGTGAGGAC
CCGGGACCCGAGATCCTCGACCTCATCGACACCCTCCGCCGCATCCGCGACGAGGAGCTCGAGCACCTCGACCAC
GCCGTCGAGCACGACGCCAAGAAGGCCCAGCCGCACTGGCTCCTCACCAACGCCATCAGGGCCGGCTGTCGCGGC
GCCATCTGGCTGAGTGAGCGAGTCTGA
Transcript >Hirsu2|10098
ATGGCCTCGACGCGCAGCCTCGCCCGCCGCGTCCCCCCCGGGCCGTCGACGAGGCTGGTCTGCGCCCGCCCAGCA
GCGCGCGCCTTCTCGACCCCGACAGCCGCCGACGAGAAGAAGAAGAAGCGCAGGCCGCTCACCGCGGAGCAGCGC
GACTTTCTCTCCTCCGCTCTGCGCGTCAACCAGGCGGGCGAGCTCGCCGCGACGCTCATCTACCAGGCGCAGACG
CCGCTCCTCGTCCGGCGGCACCCACACCTGCGGCCGCTGATGCGGCACATGTACGAGCAGGAGGCCGGCCACCTG
GCGACGTTCAACGCGCTGCTGCACCGGCACCGCGTCCGCCCCACGGCCCTGTACCCGCTCTGGTCCGTCCTGGCC
TCGGGCCTCGGCTGGGCCACGGCCGCCATGGGCCGCGAGGCCGCCATGGCCTGCACCGAGGCCGTCGAGACGGAG
ATCGGCGACCACTACAACGGCCAGATCCGCACCCTGCTCGAGACCGTCGCCCGCTGGGAGGCCGACGGTGAGGAC
CCGGGACCCGAGATCCTCGACCTCATCGACACCCTCCGCCGCATCCGCGACGAGGAGCTCGAGCACCTCGACCAC
GCCGTCGAGCACGACGCCAAGAAGGCCCAGCCGCACTGGCTCCTCACCAACGCCATCAGGGCCGGCTGTCGCGGC
GCCATCTGGCTGAGTGAGCGAGTCTGA
Gene >Hirsu2|10098
ATGGCCTCGACGCGCAGCCTCGCCCGCCGCGTCCCCCCCGGGCCGTCGACGAGGCTGGTCTGCGCCCGCCCAGCA
GCGCGCGCCTTCTCGACCCCGACAGCCGCCGACGAGAAGAAGAAGAAGCGCAGGCCGCTCACCGCGGAGCAGCGC
GACTTTCTCTCCTCCGCTGTGAGTCCGAACCCCCCCCCCCCACGTCCGCCGCGAAAGCTCTTCGGCTGATGCCGC
CGCAGCTGCGCGTCAACCAGGCGGGCGAGCTCGCCGCGACGCTCATCTACCAGGCGCAGACGCCGCTCCTCGTCC
GGCGGCACCCACACCTGCGGCCGCTGATGCGGCACATGTACGAGCAGGAGGCCGGCCACCTGGCGACGTTCAACG
CGCTGCTGCACCGGCACCGCGTCCGCCCCACGGCCCTGTACCCGCTCTGGTCCGTCCTGGCCTCGGGCCTCGGCT
GGGCCACGGCCGCCATGGGCCGCGAGGCCGCCATGGCCTGCACCGAGGCCGTCGAGACGGAGATCGGCGACCACT
ACAACGGCCAGATCCGCACCCTGCTCGAGACCGTCGCCCGCTGGGAGGCCGACGGTGAGGACCCGGGACCCGAGA
TCCTCGACCTCATCGACACCCTCCGCCGCATCCGCGACGAGGAGCTCGAGCACCTCGACCACGCCGTCGAGCACG
ACGCCAAGAAGGCCCAGCCGCACTGGCTCCTCACCAACGCCATCAGGGCCGGCTGTCGCGGCGCCATCTGGCTGA
GTGAGCGAGTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail