Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10087
Gene name
LocationContig_787:2625..3897
Strand-
Gene length (bp)1272
Transcript length (bp)1173
Coding sequence length (bp)1173
Protein length (aa) 391

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01650 Peptidase_C13 Peptidase C13 family 1.4E-40 29 259

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P49018|GPI8_YEAST GPI-anchor transamidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GPI8 PE=1 SV=1 19 299 2.0E-145
sp|Q9USP5|GPI8_SCHPO GPI-anchor transamidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpi8 PE=2 SV=1 21 301 5.0E-129
sp|Q3MHZ7|GPI8_BOVIN GPI-anchor transamidase OS=Bos taurus GN=PIGK PE=2 SV=1 26 301 2.0E-118
sp|Q92643|GPI8_HUMAN GPI-anchor transamidase OS=Homo sapiens GN=PIGK PE=1 SV=2 12 301 2.0E-118
sp|Q5R6L8|GPI8_PONAB GPI-anchor transamidase OS=Pongo abelii GN=PIGK PE=2 SV=1 12 301 3.0E-118
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P49018|GPI8_YEAST GPI-anchor transamidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GPI8 PE=1 SV=1 19 299 2.0E-145
sp|Q9USP5|GPI8_SCHPO GPI-anchor transamidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpi8 PE=2 SV=1 21 301 5.0E-129
sp|Q3MHZ7|GPI8_BOVIN GPI-anchor transamidase OS=Bos taurus GN=PIGK PE=2 SV=1 26 301 2.0E-118
sp|Q92643|GPI8_HUMAN GPI-anchor transamidase OS=Homo sapiens GN=PIGK PE=1 SV=2 12 301 2.0E-118
sp|Q5R6L8|GPI8_PONAB GPI-anchor transamidase OS=Pongo abelii GN=PIGK PE=2 SV=1 12 301 3.0E-118
sp|Q9CXY9|GPI8_MOUSE GPI-anchor transamidase OS=Mus musculus GN=Pigk PE=1 SV=2 26 301 3.0E-116
sp|Q4KRV1|GPI8_PIG GPI-anchor transamidase OS=Sus scrofa GN=PIGK PE=2 SV=1 26 301 8.0E-116
sp|Q8T4E1|GPI8_DROME Putative GPI-anchor transamidase OS=Drosophila melanogaster GN=CG4406 PE=2 SV=1 24 312 1.0E-113
sp|P49048|GPI8_CAEEL Putative GPI-anchor transamidase OS=Caenorhabditis elegans GN=T05E11.6 PE=1 SV=3 26 295 1.0E-100
sp|Q9R0J8|LGMN_RAT Legumain OS=Rattus norvegicus GN=Lgmn PE=1 SV=1 12 270 1.0E-29
sp|O89017|LGMN_MOUSE Legumain OS=Mus musculus GN=Lgmn PE=1 SV=1 4 270 2.0E-29
sp|Q95M12|LGMN_BOVIN Legumain OS=Bos taurus GN=LGMN PE=1 SV=1 3 270 6.0E-28
sp|Q99538|LGMN_HUMAN Legumain OS=Homo sapiens GN=LGMN PE=1 SV=1 29 270 1.0E-26
sp|Q5R5D9|LGMN_PONAB Legumain OS=Pongo abelii GN=LGMN PE=2 SV=1 29 270 1.0E-26
sp|Q4R4T8|LGMN_MACFA Legumain OS=Macaca fascicularis GN=LGMN PE=2 SV=1 29 270 2.0E-26
sp|P42665|HGLB_SCHJA Hemoglobinase OS=Schistosoma japonicum GN=HAEM PE=2 SV=1 30 235 4.0E-22
sp|P49047|VPEA_ARATH Vacuolar-processing enzyme alpha-isozyme OS=Arabidopsis thaliana GN=At2g25940 PE=2 SV=2 5 217 1.0E-21
sp|P09841|HGLB_SCHMA Hemoglobinase OS=Schistosoma mansoni PE=1 SV=3 1 235 3.0E-21
sp|Q9LJX8|VPED_ARATH Vacuolar-processing enzyme delta-isozyme OS=Arabidopsis thaliana GN=dVPE PE=1 SV=1 28 204 6.0E-21
sp|Q39044|VPEB_ARATH Vacuolar-processing enzyme beta-isozyme OS=Arabidopsis thaliana GN=bVPE PE=2 SV=3 28 217 4.0E-20
sp|Q39119|VPEG_ARATH Vacuolar-processing enzyme gamma-isozyme OS=Arabidopsis thaliana GN=At4g32940 PE=2 SV=2 28 218 1.0E-19
sp|P49043|VPE_CITSI Vacuolar-processing enzyme OS=Citrus sinensis PE=2 SV=1 28 218 1.0E-18
sp|P49044|VPE_VICSA Vacuolar-processing enzyme OS=Vicia sativa PE=1 SV=1 30 224 2.0E-18
sp|O24325|VPE1_PHAVU Vacuolar-processing enzyme OS=Phaseolus vulgaris PE=1 SV=1 26 218 6.0E-18
sp|Q84LM2|VPE1_ORYSJ Vacuolar-processing enzyme beta-isozyme 1 OS=Oryza sativa subsp. japonica GN=VPE1 PE=1 SV=1 28 215 6.0E-18
sp|P49046|LEGU_CANEN Legumain OS=Canavalia ensiformis PE=1 SV=1 25 218 2.0E-17
sp|B8ASK4|VPE1_ORYSI Vacuolar-processing enzyme beta-isozyme 1 OS=Oryza sativa subsp. indica GN=OsI_16797 PE=3 SV=1 28 215 7.0E-17
sp|O24326|VPE2_PHAVU Vacuolar-processing enzyme OS=Phaseolus vulgaris PE=2 SV=1 25 218 2.0E-16
sp|P49045|VPE_SOYBN Vacuolar-processing enzyme OS=Glycine max PE=2 SV=1 25 218 1.0E-15
sp|P49042|VPE_RICCO Vacuolar-processing enzyme OS=Ricinus communis PE=1 SV=1 28 218 3.0E-15
[Show less]

GO

GO Term Description Terminal node
GO:0008233 peptidase activity Yes
GO:0006508 proteolysis Yes
GO:0140096 catalytic activity, acting on a protein No
GO:1901564 organonitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0003824 catalytic activity No
GO:0008152 metabolic process No
GO:0019538 protein metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0044238 primary metabolic process No
GO:0008150 biological_process No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No
GO:0006807 nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10087
MKLWDLFPLAPLALLALLAPGAVAEHTSNWAVLVCTSRFWFNYRHLANVLSMYRTVKRLGIPDSQIILMLPDDMA
CNPRNAFPGTVYSNSDRAVDLYGDNIEVDYRGYEVTVENFIRLLTDRVGAEMPRSKRLLTDNRSNILVYMTGHGG
NEFLKFQDAEEIGAYDLADAFEQMWEKKRYHEILFMIDTCQANTMYSRLYSPNIIATGSSELDQSSYSHHADNDV
GVAVIDRYTYYNLEFLENQVQDLNSRRTVGDLFDSYDYEKIHSNAGVRYDLFPGGAEAARSRLITDFFGNVQNVE
VDRANDSAMEEELVALSKTIALLREKEAEAHDNATSVPPPASAAPTQPARKTRPVAALTDDDRWTKKAVGVSALA
GCALLWGVGVLLESR*
Coding >Hirsu2|10087
ATGAAGCTCTGGGACCTGTTCCCGCTGGCGCCGCTGGCGCTGCTGGCGCTCCTGGCGCCGGGCGCCGTTGCGGAG
CACACGAGCAACTGGGCGGTGCTGGTGTGCACGTCGCGCTTCTGGTTCAACTACCGGCACCTGGCCAACGTGCTG
TCCATGTACCGGACGGTCAAGCGGCTCGGCATCCCGGACTCGCAGATCATCCTGATGCTGCCGGACGACATGGCG
TGCAACCCGCGCAACGCCTTCCCCGGCACCGTCTACAGCAACTCGGACCGGGCCGTCGACCTGTACGGCGACAAC
ATCGAGGTCGACTACCGCGGCTACGAGGTGACGGTCGAGAACTTCATCCGCCTGCTGACGGACCGCGTCGGCGCC
GAGATGCCGCGCAGCAAGCGCCTCCTGACCGACAACCGGAGCAACATCCTCGTCTACATGACCGGCCACGGCGGC
AACGAGTTCCTCAAGTTCCAGGACGCCGAGGAGATTGGCGCGTACGACCTCGCCGACGCGTTTGAGCAGATGTGG
GAGAAGAAGAGATACCACGAGATCCTCTTCATGATCGACACGTGCCAGGCAAACACCATGTACAGCAGGCTCTAC
TCGCCCAACATCATCGCGACCGGGTCGTCGGAGCTCGACCAGTCGTCGTACTCGCACCACGCCGACAACGACGTG
GGCGTCGCCGTCATCGACCGATACACCTACTACAACCTCGAGTTCCTCGAGAACCAGGTGCAGGACCTCAACAGC
AGGAGGACGGTGGGCGACCTGTTCGACAGCTACGACTACGAGAAGATCCACTCCAACGCGGGCGTGCGCTACGAC
CTGTTCCCCGGCGGCGCCGAGGCGGCCCGGAGCCGACTCATCACCGACTTCTTCGGCAACGTCCAGAACGTCGAG
GTCGACCGGGCCAACGACTCGGCCATGGAGGAGGAGCTCGTCGCGCTGAGCAAGACGATTGCCCTCCTCCGCGAG
AAGGAGGCCGAGGCCCACGACAACGCCACGTCGGTGCCGCCGCCCGCGAGCGCGGCCCCGACTCAGCCGGCCAGG
AAGACGCGACCCGTCGCCGCGCTCACCGACGACGACCGATGGACGAAGAAGGCCGTCGGCGTCTCGGCCCTGGCC
GGCTGTGCCCTCCTCTGGGGCGTGGGCGTCTTGTTGGAGAGTCGATGA
Transcript >Hirsu2|10087
ATGAAGCTCTGGGACCTGTTCCCGCTGGCGCCGCTGGCGCTGCTGGCGCTCCTGGCGCCGGGCGCCGTTGCGGAG
CACACGAGCAACTGGGCGGTGCTGGTGTGCACGTCGCGCTTCTGGTTCAACTACCGGCACCTGGCCAACGTGCTG
TCCATGTACCGGACGGTCAAGCGGCTCGGCATCCCGGACTCGCAGATCATCCTGATGCTGCCGGACGACATGGCG
TGCAACCCGCGCAACGCCTTCCCCGGCACCGTCTACAGCAACTCGGACCGGGCCGTCGACCTGTACGGCGACAAC
ATCGAGGTCGACTACCGCGGCTACGAGGTGACGGTCGAGAACTTCATCCGCCTGCTGACGGACCGCGTCGGCGCC
GAGATGCCGCGCAGCAAGCGCCTCCTGACCGACAACCGGAGCAACATCCTCGTCTACATGACCGGCCACGGCGGC
AACGAGTTCCTCAAGTTCCAGGACGCCGAGGAGATTGGCGCGTACGACCTCGCCGACGCGTTTGAGCAGATGTGG
GAGAAGAAGAGATACCACGAGATCCTCTTCATGATCGACACGTGCCAGGCAAACACCATGTACAGCAGGCTCTAC
TCGCCCAACATCATCGCGACCGGGTCGTCGGAGCTCGACCAGTCGTCGTACTCGCACCACGCCGACAACGACGTG
GGCGTCGCCGTCATCGACCGATACACCTACTACAACCTCGAGTTCCTCGAGAACCAGGTGCAGGACCTCAACAGC
AGGAGGACGGTGGGCGACCTGTTCGACAGCTACGACTACGAGAAGATCCACTCCAACGCGGGCGTGCGCTACGAC
CTGTTCCCCGGCGGCGCCGAGGCGGCCCGGAGCCGACTCATCACCGACTTCTTCGGCAACGTCCAGAACGTCGAG
GTCGACCGGGCCAACGACTCGGCCATGGAGGAGGAGCTCGTCGCGCTGAGCAAGACGATTGCCCTCCTCCGCGAG
AAGGAGGCCGAGGCCCACGACAACGCCACGTCGGTGCCGCCGCCCGCGAGCGCGGCCCCGACTCAGCCGGCCAGG
AAGACGCGACCCGTCGCCGCGCTCACCGACGACGACCGATGGACGAAGAAGGCCGTCGGCGTCTCGGCCCTGGCC
GGCTGTGCCCTCCTCTGGGGCGTGGGCGTCTTGTTGGAGAGTCGATGA
Gene >Hirsu2|10087
ATGAAGCTCTGGGACCTGTTCCCGCTGGCGCCGCTGGCGCTGCTGGCGCTCCTGGCGCCGGGCGCCGTTGCGGAG
CACACGAGCAACTGGGCGGTGCTGGTGTGCACGTCGCGCTTCTGGTTCAACTACCGGCACCTGGCCAACGTGCTG
TCCATGTACCGGACGGTCAAGCGGCTCGGCATCCCGGACTCGCAGATCATCCTGATGCTGCCGGACGACATGGCG
TGCAACCCGCGCAACGCCTTCCCCGGCACCGTCTACAGCAACTCGGACCGGGCCGTCGACCTGTACGGCGACAAC
ATCGAGGTCGACTACCGCGGCTACGAGGTGACGGTCGAGAACTTCATCCGCCTGCTGACGGACCGCGTCGGCGCC
GAGATGCCGCGCAGCAAGCGCCTCCTGACCGACAACCGGAGCAACATCCTCGTCTACATGACCGGCCACGGCGGC
AACGAGTTCCTCAAGTTCCAGGACGCCGAGGAGATTGGCGCGTACGACCTCGCCGACGCGTTTGAGCAGATGTGG
GAGAAGAAGAGGCAGGTCCCCTCCTTCTTTTTCGCATGCCCCTTTCAGAGGCCATTGAACGTTCTGCGAGAGCGG
AGAGGCTGACGGCGCTTTTGCCTCCCCCCCATCAGATACCACGAGATCCTCTTCATGATCGACACGTGCCAGGCA
AACACCATGTACAGCAGGCTCTACTCGCCCAACATCATCGCGACCGGGTCGTCGGAGCTCGACCAGTCGTCGTAC
TCGCACCACGCCGACAACGACGTGGGCGTCGCCGTCATCGACCGATACACCTACTACAACCTCGAGTTCCTCGAG
AACCAGGTGCAGGACCTCAACAGCAGGAGGACGGTGGGCGACCTGTTCGACAGCTACGACTACGAGAAGATCCAC
TCCAACGCGGGCGTGCGCTACGACCTGTTCCCCGGCGGCGCCGAGGCGGCCCGGAGCCGACTCATCACCGACTTC
TTCGGCAACGTCCAGAACGTCGAGGTCGACCGGGCCAACGACTCGGCCATGGAGGAGGAGCTCGTCGCGCTGAGC
AAGACGATTGCCCTCCTCCGCGAGAAGGAGGCCGAGGCCCACGACAACGCCACGTCGGTGCCGCCGCCCGCGAGC
GCGGCCCCGACTCAGCCGGCCAGGAAGACGCGACCCGTCGCCGCGCTCACCGACGACGACCGATGGACGAAGAAG
GCCGTCGGCGTCTCGGCCCTGGCCGGCTGTGCCCTCCTCTGGGGCGTGGGCGTCTTGTTGGAGAGTCGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail