Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10069
Gene name
LocationContig_783:3516..4671
Strand-
Gene length (bp)1155
Transcript length (bp)1155
Coding sequence length (bp)1155
Protein length (aa) 385

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13324 GCIP Grap2 and cyclin-D-interacting 3.6E-21 63 341
PF14246 TetR_C_7 AefR-like transcriptional repressor, C-terminal domain 1.4E-05 311 373

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q10368|YDBI_SCHPO Uncharacterized protein C22E12.18 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22E12.18 PE=1 SV=1 57 374 3.0E-12

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10069
MSPPPSADSLQRLDALVQTASALLAQLQSALSEIQKDPSQGPPAPSDASAANPPDALALAHDSASLIRAQGTKVS
LLIINEPLTPSAICSVVGELVSGPVPAIVSAAQICHPAQYSVVLRRELALLSRRVLAELNELLKKIPKDGKVLSG
LAHAGSDSGKKGSIQVTGILWSACDDLIKLTKMGAGGLLAEKTRQWGDMLKDISEELKEWGEESSEDGDDGSGED
DDVDDLVGQLGDAHVSAQDMIDDLMNSHSSIPRHDPDRIRPRLDATLKRLRLVALLYEAARARRFSKLPALPPAA
AGSDVPSRLDELARLLQRLPERFEDLAGAFYELQPADIDAAMDQCLVDAVAAGELLANDWNGAADAFTQWITRFR
AEMKMPDGL*
Coding >Hirsu2|10069
ATGTCGCCTCCGCCGTCCGCAGACTCGCTCCAAAGGCTGGACGCCCTGGTCCAAACAGCCTCTGCCCTCCTCGCG
CAGCTGCAGAGCGCCCTGTCCGAGATACAAAAAGATCCGTCGCAAGGACCACCAGCGCCGTCAGACGCGTCTGCG
GCCAATCCACCTGATGCCTTGGCCCTCGCTCACGACTCGGCCTCGCTCATCAGAGCGCAGGGGACCAAGGTCTCG
CTGCTCATCATCAACGAACCTCTGACCCCCAGCGCCATCTGTTCCGTCGTCGGCGAGCTGGTGTCCGGGCCGGTG
CCTGCCATTGTCTCTGCGGCCCAGATATGCCATCCTGCACAGTACAGCGTCGTGCTTCGGCGCGAGTTGGCTCTG
CTAAGCCGCCGGGTCCTCGCCGAGCTGAACGAGCTTCTCAAGAAGATACCAAAGGACGGCAAGGTCCTGTCCGGC
CTTGCACACGCGGGCTCCGACTCCGGCAAGAAAGGCAGCATTCAGGTCACCGGTATCCTCTGGTCCGCCTGCGAC
GACCTAATCAAGCTCACCAAGATGGGCGCGGGCGGCCTGCTTGCCGAGAAGACGAGGCAGTGGGGGGATATGCTG
AAAGACATCTCCGAAGAGCTCAAGGAATGGGGTGAAGAATCATCAGAGGACGGCGACGACGGGTCGGGCGAGGAC
GACGACGTGGACGACTTGGTCGGCCAACTGGGGGACGCTCACGTCTCCGCCCAGGACATGATCGACGACTTGATG
AACTCGCATAGCTCCATTCCACGCCATGACCCCGATCGCATACGGCCGCGCCTGGACGCCACGCTCAAGCGCCTT
CGCCTCGTCGCTCTCTTGTACGAAGCCGCCCGGGCTCGCCGCTTCAGCAAGCTTCCCGCGCTGCCCCCCGCCGCG
GCGGGATCCGACGTGCCGTCCCGACTGGATGAACTGGCGCGTCTTCTGCAGAGGCTGCCCGAACGATTTGAGGAT
CTGGCCGGTGCCTTTTACGAGCTGCAGCCCGCCGATATTGACGCGGCCATGGATCAGTGTCTTGTCGACGCCGTG
GCCGCGGGCGAGCTGCTGGCCAACGACTGGAACGGCGCGGCCGATGCCTTTACACAGTGGATTACGCGGTTCCGG
GCGGAAATGAAGATGCCTGACGGACTATGA
Transcript >Hirsu2|10069
ATGTCGCCTCCGCCGTCCGCAGACTCGCTCCAAAGGCTGGACGCCCTGGTCCAAACAGCCTCTGCCCTCCTCGCG
CAGCTGCAGAGCGCCCTGTCCGAGATACAAAAAGATCCGTCGCAAGGACCACCAGCGCCGTCAGACGCGTCTGCG
GCCAATCCACCTGATGCCTTGGCCCTCGCTCACGACTCGGCCTCGCTCATCAGAGCGCAGGGGACCAAGGTCTCG
CTGCTCATCATCAACGAACCTCTGACCCCCAGCGCCATCTGTTCCGTCGTCGGCGAGCTGGTGTCCGGGCCGGTG
CCTGCCATTGTCTCTGCGGCCCAGATATGCCATCCTGCACAGTACAGCGTCGTGCTTCGGCGCGAGTTGGCTCTG
CTAAGCCGCCGGGTCCTCGCCGAGCTGAACGAGCTTCTCAAGAAGATACCAAAGGACGGCAAGGTCCTGTCCGGC
CTTGCACACGCGGGCTCCGACTCCGGCAAGAAAGGCAGCATTCAGGTCACCGGTATCCTCTGGTCCGCCTGCGAC
GACCTAATCAAGCTCACCAAGATGGGCGCGGGCGGCCTGCTTGCCGAGAAGACGAGGCAGTGGGGGGATATGCTG
AAAGACATCTCCGAAGAGCTCAAGGAATGGGGTGAAGAATCATCAGAGGACGGCGACGACGGGTCGGGCGAGGAC
GACGACGTGGACGACTTGGTCGGCCAACTGGGGGACGCTCACGTCTCCGCCCAGGACATGATCGACGACTTGATG
AACTCGCATAGCTCCATTCCACGCCATGACCCCGATCGCATACGGCCGCGCCTGGACGCCACGCTCAAGCGCCTT
CGCCTCGTCGCTCTCTTGTACGAAGCCGCCCGGGCTCGCCGCTTCAGCAAGCTTCCCGCGCTGCCCCCCGCCGCG
GCGGGATCCGACGTGCCGTCCCGACTGGATGAACTGGCGCGTCTTCTGCAGAGGCTGCCCGAACGATTTGAGGAT
CTGGCCGGTGCCTTTTACGAGCTGCAGCCCGCCGATATTGACGCGGCCATGGATCAGTGTCTTGTCGACGCCGTG
GCCGCGGGCGAGCTGCTGGCCAACGACTGGAACGGCGCGGCCGATGCCTTTACACAGTGGATTACGCGGTTCCGG
GCGGAAATGAAGATGCCTGACGGACTATGA
Gene >Hirsu2|10069
ATGTCGCCTCCGCCGTCCGCAGACTCGCTCCAAAGGCTGGACGCCCTGGTCCAAACAGCCTCTGCCCTCCTCGCG
CAGCTGCAGAGCGCCCTGTCCGAGATACAAAAAGATCCGTCGCAAGGACCACCAGCGCCGTCAGACGCGTCTGCG
GCCAATCCACCTGATGCCTTGGCCCTCGCTCACGACTCGGCCTCGCTCATCAGAGCGCAGGGGACCAAGGTCTCG
CTGCTCATCATCAACGAACCTCTGACCCCCAGCGCCATCTGTTCCGTCGTCGGCGAGCTGGTGTCCGGGCCGGTG
CCTGCCATTGTCTCTGCGGCCCAGATATGCCATCCTGCACAGTACAGCGTCGTGCTTCGGCGCGAGTTGGCTCTG
CTAAGCCGCCGGGTCCTCGCCGAGCTGAACGAGCTTCTCAAGAAGATACCAAAGGACGGCAAGGTCCTGTCCGGC
CTTGCACACGCGGGCTCCGACTCCGGCAAGAAAGGCAGCATTCAGGTCACCGGTATCCTCTGGTCCGCCTGCGAC
GACCTAATCAAGCTCACCAAGATGGGCGCGGGCGGCCTGCTTGCCGAGAAGACGAGGCAGTGGGGGGATATGCTG
AAAGACATCTCCGAAGAGCTCAAGGAATGGGGTGAAGAATCATCAGAGGACGGCGACGACGGGTCGGGCGAGGAC
GACGACGTGGACGACTTGGTCGGCCAACTGGGGGACGCTCACGTCTCCGCCCAGGACATGATCGACGACTTGATG
AACTCGCATAGCTCCATTCCACGCCATGACCCCGATCGCATACGGCCGCGCCTGGACGCCACGCTCAAGCGCCTT
CGCCTCGTCGCTCTCTTGTACGAAGCCGCCCGGGCTCGCCGCTTCAGCAAGCTTCCCGCGCTGCCCCCCGCCGCG
GCGGGATCCGACGTGCCGTCCCGACTGGATGAACTGGCGCGTCTTCTGCAGAGGCTGCCCGAACGATTTGAGGAT
CTGGCCGGTGCCTTTTACGAGCTGCAGCCCGCCGATATTGACGCGGCCATGGATCAGTGTCTTGTCGACGCCGTG
GCCGCGGGCGAGCTGCTGGCCAACGACTGGAACGGCGCGGCCGATGCCTTTACACAGTGGATTACGCGGTTCCGG
GCGGAAATGAAGATGCCTGACGGACTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail