Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10068
Gene name
LocationContig_783:689..2582
Strand-
Gene length (bp)1893
Transcript length (bp)1686
Coding sequence length (bp)1686
Protein length (aa) 562

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12999 PRKCSH-like Glucosidase II beta subunit-like 8.0E-15 14 77
PF12999 PRKCSH-like Glucosidase II beta subunit-like 5.3E-23 90 203
PF13015 PRKCSH_1 Glucosidase II beta subunit-like protein 3.3E-28 405 549

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USH8|GLU2B_SCHPO Glucosidase 2 subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gtb1 PE=1 SV=1 7 553 4.0E-51
sp|P0CT24|GLU2B_USTMA Glucosidase 2 subunit beta OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_12045 PE=3 SV=1 47 548 2.0E-50
sp|P14314|GLU2B_HUMAN Glucosidase 2 subunit beta OS=Homo sapiens GN=PRKCSH PE=1 SV=2 25 223 2.0E-21
sp|Q28034|GLU2B_BOVIN Glucosidase 2 subunit beta OS=Bos taurus GN=PRKCSH PE=2 SV=1 25 205 2.0E-19
sp|O08795|GLU2B_MOUSE Glucosidase 2 subunit beta OS=Mus musculus GN=Prkcsh PE=1 SV=1 25 223 4.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USH8|GLU2B_SCHPO Glucosidase 2 subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gtb1 PE=1 SV=1 7 553 4.0E-51
sp|P0CT24|GLU2B_USTMA Glucosidase 2 subunit beta OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_12045 PE=3 SV=1 47 548 2.0E-50
sp|P14314|GLU2B_HUMAN Glucosidase 2 subunit beta OS=Homo sapiens GN=PRKCSH PE=1 SV=2 25 223 2.0E-21
sp|Q28034|GLU2B_BOVIN Glucosidase 2 subunit beta OS=Bos taurus GN=PRKCSH PE=2 SV=1 25 205 2.0E-19
sp|O08795|GLU2B_MOUSE Glucosidase 2 subunit beta OS=Mus musculus GN=Prkcsh PE=1 SV=1 25 223 4.0E-19
sp|Q9FM96|PSL4_ARATH Glucosidase 2 subunit beta OS=Arabidopsis thaliana GN=PSL4 PE=2 SV=1 27 219 6.0E-18
sp|Q5NBP9|GLU2B_ORYSJ Glucosidase 2 subunit beta OS=Oryza sativa subsp. japonica GN=Os01g0276800 PE=2 SV=1 16 205 3.0E-17
sp|A2WNF5|GLU2B_ORYSI Glucosidase 2 subunit beta OS=Oryza sativa subsp. indica GN=OsI_01383 PE=3 SV=1 16 205 3.0E-17
sp|Q04924|GLU2B_YEAST Glucosidase 2 subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GTB1 PE=1 SV=1 7 298 7.0E-17
sp|Q9FM96|PSL4_ARATH Glucosidase 2 subunit beta OS=Arabidopsis thaliana GN=PSL4 PE=2 SV=1 342 546 2.0E-11
sp|P14314|GLU2B_HUMAN Glucosidase 2 subunit beta OS=Homo sapiens GN=PRKCSH PE=1 SV=2 394 540 5.0E-11
sp|Q28034|GLU2B_BOVIN Glucosidase 2 subunit beta OS=Bos taurus GN=PRKCSH PE=2 SV=1 394 542 8.0E-11
sp|O08795|GLU2B_MOUSE Glucosidase 2 subunit beta OS=Mus musculus GN=Prkcsh PE=1 SV=1 390 542 2.0E-10
sp|Q5NBP9|GLU2B_ORYSJ Glucosidase 2 subunit beta OS=Oryza sativa subsp. japonica GN=Os01g0276800 PE=2 SV=1 419 547 4.0E-08
sp|A2WNF5|GLU2B_ORYSI Glucosidase 2 subunit beta OS=Oryza sativa subsp. indica GN=OsI_01383 PE=3 SV=1 419 547 4.0E-08
sp|Q04924|GLU2B_YEAST Glucosidase 2 subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GTB1 PE=1 SV=1 495 556 6.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10068
MQQPRNWVLLAAASSLTAAAAGSLPRGVGPEFAKHYDGKSDFACITDASIKLSPSRVNDNTCDCPDGSDEPGTAA
CAYIDPLSPEQPLPGSVSGSTNATNALPGFWCVNEGHIGAYVPFSYVNDGVCDHELCCDGSEEFAGVGGVKCPNR
CAEIGKEHRKREEEKRKNMDKAQKKRAAMLSEAKQLRQQAEARLAQYAGDIKLLEAKKAELQKKHAEAEASHRGK
VVTGQGSGGKLGVLVGLAKKRVEELRSALDLVLQERKTAQGHVDELRTILTKLKEDYNPNFNDEGVKAAIKAFED
YAARQSADVPASSPESNFDEIVKEDSAESGVNWGEFEELGDDTDILYSIEAYLPAFLRNMLQSKMMDLRLWLIRN
GMLAEKVKEGSESQVVKAAREAAEAAERELQDKIRERDGDKEDLAKDYGPSDIFRALKGKIVSVEAGEYTYELGW
LEQTAQKSKKGHGNTNMGNFVRIDRQMADDEERADGKSLGKGERMVMRYENGLGCWNGPQRRTDVWLGCAETEEL
WRVSEAEKCVYKMEVGTPAACEPDEDSQRPRGKDEL*
Coding >Hirsu2|10068
ATGCAGCAGCCCCGGAATTGGGTGCTGCTGGCCGCCGCCTCCTCCTTGACAGCGGCTGCTGCTGGCAGTCTGCCG
CGCGGCGTCGGTCCAGAATTTGCCAAGCACTACGACGGCAAGTCGGACTTTGCCTGCATCACCGACGCCTCCATC
AAGCTCAGCCCGTCTAGAGTCAACGACAACACGTGCGACTGCCCCGACGGCTCCGACGAGCCCGGCACCGCCGCC
TGCGCTTACATCGACCCCCTCTCTCCCGAACAACCGCTGCCAGGCTCTGTCTCCGGCAGCACCAACGCCACCAAC
GCCCTCCCCGGCTTCTGGTGCGTCAACGAAGGCCATATCGGCGCCTACGTGCCCTTCTCATACGTCAACGACGGA
GTCTGCGACCACGAGCTCTGCTGCGACGGCAGCGAGGAGTTTGCCGGCGTCGGCGGCGTCAAGTGCCCGAACCGC
TGTGCCGAGATCGGCAAGGAGCATCGGAAGCGGGAGGAGGAGAAGCGTAAGAACATGGACAAGGCCCAGAAGAAG
AGGGCCGCCATGCTGTCCGAGGCCAAGCAGCTTCGCCAGCAGGCCGAGGCCCGACTGGCTCAGTATGCCGGCGAC
ATCAAGCTTCTCGAAGCCAAGAAGGCAGAGCTGCAGAAGAAGCACGCCGAAGCAGAGGCCTCGCACCGGGGCAAG
GTCGTGACGGGCCAGGGCAGCGGCGGCAAGCTCGGCGTGCTTGTCGGTCTGGCCAAGAAAAGGGTCGAAGAGCTG
CGCTCCGCCCTCGACCTAGTCCTCCAGGAAAGGAAGACGGCGCAGGGGCACGTCGACGAGCTCCGGACCATCCTC
ACGAAGCTCAAGGAGGACTACAACCCCAACTTCAACGACGAGGGCGTCAAGGCGGCCATCAAGGCCTTTGAGGAC
TACGCCGCGCGCCAGAGCGCCGACGTCCCCGCCTCCTCCCCCGAATCAAACTTTGATGAGATTGTCAAGGAGGAC
AGTGCCGAGAGCGGCGTGAACTGGGGCGAGTTCGAGGAGCTCGGCGACGACACCGACATCTTGTACAGCATCGAG
GCCTACCTTCCGGCCTTCCTCCGCAACATGCTTCAGAGCAAGATGATGGACCTGAGGCTGTGGCTGATCCGGAAC
GGCATGCTGGCGGAAAAGGTCAAGGAGGGATCGGAATCGCAGGTTGTCAAGGCGGCCCGCGAGGCGGCGGAGGCG
GCAGAGAGAGAGCTGCAGGACAAGATCAGGGAGCGTGACGGCGACAAGGAGGACCTGGCCAAGGACTACGGCCCG
TCGGACATCTTCCGCGCGCTCAAGGGCAAGATCGTCAGCGTCGAGGCGGGCGAGTACACGTACGAGCTCGGCTGG
CTGGAGCAGACAGCGCAGAAGTCCAAGAAGGGCCACGGCAACACCAACATGGGCAACTTTGTGCGCATCGACCGC
CAGATGGCCGACGACGAGGAGAGGGCGGACGGCAAGAGCCTCGGCAAGGGCGAGCGAATGGTGATGCGGTACGAG
AACGGGCTGGGCTGCTGGAACGGGCCGCAGAGGCGAACGGACGTCTGGCTCGGCTGCGCCGAGACGGAGGAGCTG
TGGCGCGTCAGCGAGGCTGAGAAGTGCGTGTACAAGATGGAGGTGGGCACGCCGGCCGCCTGCGAGCCGGACGAG
GACAGCCAGCGGCCGCGCGGCAAGGACGAGCTGTAG
Transcript >Hirsu2|10068
ATGCAGCAGCCCCGGAATTGGGTGCTGCTGGCCGCCGCCTCCTCCTTGACAGCGGCTGCTGCTGGCAGTCTGCCG
CGCGGCGTCGGTCCAGAATTTGCCAAGCACTACGACGGCAAGTCGGACTTTGCCTGCATCACCGACGCCTCCATC
AAGCTCAGCCCGTCTAGAGTCAACGACAACACGTGCGACTGCCCCGACGGCTCCGACGAGCCCGGCACCGCCGCC
TGCGCTTACATCGACCCCCTCTCTCCCGAACAACCGCTGCCAGGCTCTGTCTCCGGCAGCACCAACGCCACCAAC
GCCCTCCCCGGCTTCTGGTGCGTCAACGAAGGCCATATCGGCGCCTACGTGCCCTTCTCATACGTCAACGACGGA
GTCTGCGACCACGAGCTCTGCTGCGACGGCAGCGAGGAGTTTGCCGGCGTCGGCGGCGTCAAGTGCCCGAACCGC
TGTGCCGAGATCGGCAAGGAGCATCGGAAGCGGGAGGAGGAGAAGCGTAAGAACATGGACAAGGCCCAGAAGAAG
AGGGCCGCCATGCTGTCCGAGGCCAAGCAGCTTCGCCAGCAGGCCGAGGCCCGACTGGCTCAGTATGCCGGCGAC
ATCAAGCTTCTCGAAGCCAAGAAGGCAGAGCTGCAGAAGAAGCACGCCGAAGCAGAGGCCTCGCACCGGGGCAAG
GTCGTGACGGGCCAGGGCAGCGGCGGCAAGCTCGGCGTGCTTGTCGGTCTGGCCAAGAAAAGGGTCGAAGAGCTG
CGCTCCGCCCTCGACCTAGTCCTCCAGGAAAGGAAGACGGCGCAGGGGCACGTCGACGAGCTCCGGACCATCCTC
ACGAAGCTCAAGGAGGACTACAACCCCAACTTCAACGACGAGGGCGTCAAGGCGGCCATCAAGGCCTTTGAGGAC
TACGCCGCGCGCCAGAGCGCCGACGTCCCCGCCTCCTCCCCCGAATCAAACTTTGATGAGATTGTCAAGGAGGAC
AGTGCCGAGAGCGGCGTGAACTGGGGCGAGTTCGAGGAGCTCGGCGACGACACCGACATCTTGTACAGCATCGAG
GCCTACCTTCCGGCCTTCCTCCGCAACATGCTTCAGAGCAAGATGATGGACCTGAGGCTGTGGCTGATCCGGAAC
GGCATGCTGGCGGAAAAGGTCAAGGAGGGATCGGAATCGCAGGTTGTCAAGGCGGCCCGCGAGGCGGCGGAGGCG
GCAGAGAGAGAGCTGCAGGACAAGATCAGGGAGCGTGACGGCGACAAGGAGGACCTGGCCAAGGACTACGGCCCG
TCGGACATCTTCCGCGCGCTCAAGGGCAAGATCGTCAGCGTCGAGGCGGGCGAGTACACGTACGAGCTCGGCTGG
CTGGAGCAGACAGCGCAGAAGTCCAAGAAGGGCCACGGCAACACCAACATGGGCAACTTTGTGCGCATCGACCGC
CAGATGGCCGACGACGAGGAGAGGGCGGACGGCAAGAGCCTCGGCAAGGGCGAGCGAATGGTGATGCGGTACGAG
AACGGGCTGGGCTGCTGGAACGGGCCGCAGAGGCGAACGGACGTCTGGCTCGGCTGCGCCGAGACGGAGGAGCTG
TGGCGCGTCAGCGAGGCTGAGAAGTGCGTGTACAAGATGGAGGTGGGCACGCCGGCCGCCTGCGAGCCGGACGAG
GACAGCCAGCGGCCGCGCGGCAAGGACGAGCTGTAG
Gene >Hirsu2|10068
ATGCAGCAGCCCCGGAATTGGGTGCTGCTGGCCGCCGCCTCCTCCTTGACAGCGGCTGCTGCTGGCAGTCTGCCG
CGCGGCGTCGGTCCAGAATGTCGGTTGGCCTCTGCTACTACTCCTGCTGTTGCCGTCGCCACCAGCTGCTCTACA
GATGGGCGATGGCGTCTTCTGGCAACTATAACAAGGCAGCATGAAAGCGAGCGCGTGGATTCTTATCGCTGACAC
GGGCGCACGCAGTTGCCAAGCACTACGACGGCAAGTCGGACTTTGCCTGCATCACCGACGCCTCCATCAAGCTCA
GCCCGTCTAGAGTCAACGACAACACGTGCGACTGCCCCGACGGCTCCGACGAGCCCGGCACCGCCGCCTGCGCTT
ACATCGACCCCCTCTCTCCCGAACAACCGCTGCCAGGCTCTGTCTCCGGCAGCACCAACGCCACCAACGCCCTCC
CCGGCTTCTGGTGCGTCAACGAAGGCCATATCGGCGCCTACGTGCCCTTCTCATACGTCAACGACGGAGTCTGCG
ACCACGAGCTCTGCTGCGACGGCAGCGAGGAGTTTGCCGGCGTCGGCGGCGTCAAGTGCCCGAACCGCTGTGCCG
AGATCGGCAAGGAGCATCGGAAGCGGGAGGAGGAGAAGCGTAAGAACATGGACAAGGCCCAGAAGAAGAGGGCCG
CCATGCTGTCCGAGGCCAAGCAGCTTCGCCAGCAGGCCGAGGCCCGACTGGCTCAGTATGCCGGCGACATCAAGC
TTCTCGAAGCCAAGAAGGCAGAGCTGCAGAAGAAGCACGCCGAAGCAGAGGCCTCGCACCGGGGCAAGGTCGTGA
CGGGCCAGGGCAGCGGCGGCAAGCTCGGCGTGCTTGTCGGTCTGGCCAAGAAAAGGGTCGAAGAGCTGCGCTCCG
CCCTCGACCTAGTCCTCCAGGAAAGGAAGACGGCGCAGGGGCACGTCGACGAGCTCCGGACCATCCTCACGAAGC
TCAAGGAGGACTACAACCCCAACTTCAACGACGAGGGCGTCAAGGCGGCCATCAAGGCCTTTGAGGACTACGCCG
CGCGCCAGAGCGCCGACGTCCCCGCCTCCTCCCCCGAATCAAACTTTGATGAGATTGTCAAGGAGGACAGTGCCG
AGAGCGGCGTGAACTGGGGCGAGTTCGAGGAGCTCGGCGACGACACCGACATCTGTAAGTGGAGCCACACTCGTT
CCGTGTGGATTCTCGTCTGACGGTGCTTGCGTCCCACCATCAGTGTACAGCATCGAGGCCTACCTTCCGGCCTTC
CTCCGCAACATGCTTCAGAGCAAGATGATGGACCTGAGGCTGTGGCTGATCCGGAACGGCATGCTGGCGGAAAAG
GTCAAGGAGGGATCGGAATCGCAGGTTGTCAAGGCGGCCCGCGAGGCGGCGGAGGCGGCAGAGAGAGAGCTGCAG
GACAAGATCAGGGAGCGTGACGGCGACAAGGAGGACCTGGCCAAGGACTACGGCCCGTCGGACATCTTCCGCGCG
CTCAAGGGCAAGATCGTCAGCGTCGAGGCGGGCGAGTACACGTACGAGCTCGGCTGGCTGGAGCAGACAGCGCAG
AAGTCCAAGAAGGGCCACGGCAACACCAACATGGGCAACTTTGTGCGCATCGACCGCCAGATGGCCGACGACGAG
GAGAGGGCGGACGGCAAGAGCCTCGGCAAGGGCGAGCGAATGGTGATGCGGTACGAGAACGGGCTGGGCTGCTGG
AACGGGCCGCAGAGGCGAACGGACGTCTGGCTCGGCTGCGCCGAGACGGAGGAGCTGTGGCGCGTCAGCGAGGCT
GAGAAGTGCGTGTACAAGATGGAGGTGGGCACGCCGGCCGCCTGCGAGCCGGACGAGGACAGCCAGCGGCCGCGC
GGCAAGGACGAGCTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail